Structure of SPOC domain of the human transcriptional corepressor SHARP
VDMVQLLKKY PIVWQGLLAL KNDTAAVQLH FVSGNNVLAH RSLPLSEGGP PLRIAQRMRL EATQLEGVAR RMTVETDYCL LLALPCGRDQ EDVVSQTESL KAAFITYLQA KQAAGIINVP NPGSNQPAYV LQIFPPCEFS ESHLSRLAPD LLASISNISP HLMIVIASV
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.4 % (1806 of 2020) | 87.1 % (909 of 1044) | 92.3 % (733 of 794) | 90.1 % (164 of 182) |
Backbone | 96.7 % (992 of 1026) | 96.2 % (333 of 346) | 96.7 % (500 of 517) | 97.5 % (159 of 163) |
Sidechain | 84.3 % (979 of 1161) | 82.5 % (576 of 698) | 89.6 % (398 of 444) | 26.3 % (5 of 19) |
Aromatic | 33.3 % (36 of 108) | 33.3 % (18 of 54) | 34.0 % (18 of 53) | 0.0 % (0 of 1) |
Methyl | 96.3 % (235 of 244) | 95.9 % (117 of 122) | 96.7 % (118 of 122) |
1. SHARP
VDMVQLLKKY PIVWQGLLAL KNDTAAVQLH FVSGNNVLAH RSLPLSEGGP PLRIAQRMRL EATQLEGVAR RMTVETDYCL LLALPCGRDQ EDVVSQTESL KAAFITYLQA KQAAGIINVP NPGSNQPAYV LQIFPPCEFS ESHLSRLAPD LLASISNISP HLMIVIASV2. SMRT
YETLXDXESolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SHARP | [U-100% 13C; U-100% 15N] | protein | 0.9 mM |
2 | SMRT | natural abundance | protein | 0.9 mM |
3 | H2O | solvent | 93 % | |
4 | D2O | solvent | 7 % |
Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | SHARP | [U-15% 13C; U-100% 15N] | protein | 0.9 mM |
6 | SMRT | natural abundance | protein | 0.9 mM |
7 | H2O | solvent | 93 % | |
8 | D2O | solvent | 7 % |
Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | SMRT | [U-13C; U-15N]-Leu, Glu, Tyr, Asp | protein | 0.9 mM |
10 | SHARP | natural abundance | protein | 0.9 mM |
11 | H2O | solvent | 93 % | |
12 | D2O | solvent | 7 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | SHARP | [U-100% 13C; U-100% 15N] | protein | 0.9 mM |
14 | SMRT | natural abundance | protein | 0.9 mM |
15 | D2O | solvent | 100 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SHARP | [U-100% 13C; U-100% 15N] | protein | 0.9 mM |
2 | SMRT | natural abundance | protein | 0.9 mM |
3 | H2O | solvent | 93 % | |
4 | D2O | solvent | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SHARP | [U-100% 13C; U-100% 15N] | protein | 0.9 mM |
2 | SMRT | natural abundance | protein | 0.9 mM |
3 | H2O | solvent | 93 % | |
4 | D2O | solvent | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SHARP | [U-100% 13C; U-100% 15N] | protein | 0.9 mM |
2 | SMRT | natural abundance | protein | 0.9 mM |
3 | H2O | solvent | 93 % | |
4 | D2O | solvent | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SHARP | [U-100% 13C; U-100% 15N] | protein | 0.9 mM |
2 | SMRT | natural abundance | protein | 0.9 mM |
3 | H2O | solvent | 93 % | |
4 | D2O | solvent | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SHARP | [U-100% 13C; U-100% 15N] | protein | 0.9 mM |
2 | SMRT | natural abundance | protein | 0.9 mM |
3 | H2O | solvent | 93 % | |
4 | D2O | solvent | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SHARP | [U-100% 13C; U-100% 15N] | protein | 0.9 mM |
2 | SMRT | natural abundance | protein | 0.9 mM |
3 | H2O | solvent | 93 % | |
4 | D2O | solvent | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SHARP | [U-100% 13C; U-100% 15N] | protein | 0.9 mM |
2 | SMRT | natural abundance | protein | 0.9 mM |
3 | H2O | solvent | 93 % | |
4 | D2O | solvent | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SHARP | [U-100% 13C; U-100% 15N] | protein | 0.9 mM |
2 | SMRT | natural abundance | protein | 0.9 mM |
3 | H2O | solvent | 93 % | |
4 | D2O | solvent | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SHARP | [U-100% 13C; U-100% 15N] | protein | 0.9 mM |
2 | SMRT | natural abundance | protein | 0.9 mM |
3 | H2O | solvent | 93 % | |
4 | D2O | solvent | 7 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | SHARP | [U-100% 13C; U-100% 15N] | protein | 0.9 mM |
14 | SMRT | natural abundance | protein | 0.9 mM |
15 | D2O | solvent | 100 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | SHARP | [U-15% 13C; U-100% 15N] | protein | 0.9 mM |
6 | SMRT | natural abundance | protein | 0.9 mM |
7 | H2O | solvent | 93 % | |
8 | D2O | solvent | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | SHARP | [U-15% 13C; U-100% 15N] | protein | 0.9 mM |
6 | SMRT | natural abundance | protein | 0.9 mM |
7 | H2O | solvent | 93 % | |
8 | D2O | solvent | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | SHARP | [U-15% 13C; U-100% 15N] | protein | 0.9 mM |
6 | SMRT | natural abundance | protein | 0.9 mM |
7 | H2O | solvent | 93 % | |
8 | D2O | solvent | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SHARP | [U-100% 13C; U-100% 15N] | protein | 0.9 mM |
2 | SMRT | natural abundance | protein | 0.9 mM |
3 | H2O | solvent | 93 % | |
4 | D2O | solvent | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | SMRT | [U-13C; U-15N]-Leu, Glu, Tyr, Asp | protein | 0.9 mM |
10 | SHARP | natural abundance | protein | 0.9 mM |
11 | H2O | solvent | 93 % | |
12 | D2O | solvent | 7 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_11504_2rt5.nef |
Input source #2: Coordindates | 2rt5.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
2:4:LEU:C | 2:5:SEP:N | unknown | unknown | n/a |
2:5:SEP:C | 2:6:ASP:N | unknown | unknown | n/a |
2:6:ASP:C | 2:7:SEP:N | unknown | unknown | n/a |
2:7:SEP:C | 2:8:GLU:N | unknown | unknown | n/a |
Non-standard residues
NoneSequence alignments
----3500---3510------3520------3530------3540------3550------3560------3570------3580------3590----- VDMVQLLKKYPIVWQGLLALKNDTAAVQLHFVSGNNVLAHRSLPLSEGGPPLRIAQRMRLEATQLEGVARRMTVETDYCLLLALPCGRDQEDVVSQTESL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| VDMVQLLKKYPIVWQGLLALKNDTAAVQLHFVSGNNVLAHRSLPLSEGGPPLRIAQRMRLEATQLEGVARRMTVETDYCLLLALPCGRDQEDVVSQTESL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -3600------3610------3620------3630------3640------3650------3660--- KAAFITYLQAKQAAGIINVPNPGS..PAYVLQIFPPCEFSESHLSRLAPDLLASISNISPHLMIVIAS |||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||| KAAFITYLQAKQAAGIINVPNPGSNQPAYVLQIFPPCEFSESHLSRLAPDLLASISNISPHLMIVIASV -------110-------120-------130-------140-------150-------160---------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 169 | 3 | 0 | 98.2 |
B | B | 8 | 6 | 0 | 25.0 |
Content subtype: combined_11504_2rt5.nef
Assigned chemical shifts
----3500---3510------3520------3530------3540------3550------3560------3570------3580------3590----- VDMVQLLKKYPIVWQGLLALKNDTAAVQLHFVSGNNVLAHRSLPLSEGGPPLRIAQRMRLEATQLEGVARRMTVETDYCLLLALPCGRDQEDVVSQTESL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| VDMVQLLKKYPIVWQGLLALKNDTAAVQLHFVSGNNVLAHRSLPLSEGGPPLRIAQRMRLEATQLEGVARRMTVETDYCLLLALPCGRDQEDVVSQTESL -3600------3610------3620------3630------3640------3650------3660--- KAAFITYLQAKQAAGIINVPNPGS..PAYVLQIFPPCEFSESHLSRLAPDLLASISNISPHLMIVIAS |||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||| KAAFITYLQAKQAAGIINVPNPGS..PAYVLQIFPPCEFSESHLSRLAPDLLASISNISPHLMIVIAS
-252 E..X | | E..X
Comp_index_ID | Comp_ID |
---|
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 990 | 871 | 88.0 |
13C chemical shifts | 754 | 709 | 94.0 |
15N chemical shifts | 179 | 159 | 88.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 328 | 326 | 99.4 |
13C chemical shifts | 332 | 329 | 99.1 |
15N chemical shifts | 154 | 153 | 99.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 662 | 545 | 82.3 |
13C chemical shifts | 422 | 380 | 90.0 |
15N chemical shifts | 25 | 6 | 24.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 121 | 120 | 99.2 |
13C chemical shifts | 121 | 121 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 50 | 12 | 24.0 |
13C chemical shifts | 49 | 12 | 24.5 |
15N chemical shifts | 1 | 0 | 0.0 |
Comp_index_ID | Comp_ID |
---|
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 10 | 6 | 60.0 |
13C chemical shifts | 6 | 2 | 33.3 |
15N chemical shifts | 2 | 1 | 50.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 4 | 2 | 50.0 |
13C chemical shifts | 3 | 0 | 0.0 |
15N chemical shifts | 2 | 1 | 50.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 6 | 4 | 66.7 |
13C chemical shifts | 3 | 2 | 66.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|
Distance restraints
----3500---3510------3520------3530------3540------3550------3560------3570------3580------3590----- VDMVQLLKKYPIVWQGLLALKNDTAAVQLHFVSGNNVLAHRSLPLSEGGPPLRIAQRMRLEATQLEGVARRMTVETDYCLLLALPCGRDQEDVVSQTESL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| VDMVQLLKKYPIVWQGLLALKNDTAAVQLHFVSGNNVLAHRSLPLSEGGPPLRIAQRMRLEATQLEGVARRMTVETDYCLLLALPCGRDQEDVVSQTESL -3600------3610------3620------3630------3640------3650------3660--- KAAFITYLQAKQAAGIINVPNPGS..PAYVLQIFPPCEFSESHLSRLAPDLLASISNISPHLMIVIAS |||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||| KAAFITYLQAKQAAGIINVPNPGS..PAYVLQIFPPCEFSESHLSRLAPDLLASISNISPHLMIVIAS
----3500---3510------3520------3530------3540------3550------3560------3570------3580------3590----- VDMVQLLKKYPIVWQGLLALKNDTAAVQLHFVSGNNVLAHRSLPLSEGGPPLRIAQRMRLEATQLEGVARRMTVETDYCLLLALPCGRDQEDVVSQTESL || | || || ||||| | ||||||||| ||||||||| | | | ||||||||||||| | | |||||||| | |||||||||||| ....QL.K.YP.VW.GLLAL..D.AAVQLHFVS.NNVLAHRSL........L.I.Q.MRLEATQLEGVAR.M.V..DYCLLLAL.C..DQEDVVSQTESL -3600------3610------3620------3630------3640------3650------3660--- KAAFITYLQAKQAAGIINVPNPGS..PAYVLQIFPPCEFSESHLSRLAPDLLASISNISPHLMIVIAS ||||||||||||||||| | | | |||||| ||||||||||||| || || || ||||||| KAAFITYLQAKQAAGII.V.N..S....YVLQIF..CEFSESHLSRLAP..LA.IS.IS..LMIVIAS
Dihedral angle restraints
----3500---3510------3520------3530------3540------3550------3560------3570------3580------3590----- VDMVQLLKKYPIVWQGLLALKNDTAAVQLHFVSGNNVLAHRSLPLSEGGPPLRIAQRMRLEATQLEGVARRMTVETDYCLLLALPCGRDQEDVVSQTESL |||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||| VDMVQLLKKYPIVWQGLLALKNDTAAVQLHFVSGNNVLAHRSLP......PLRIAQRMRLEATQLEGVARRMTVETDYCLLLALPCGRDQEDVVSQTESL ----3500---3510------3520------3530------3540------3550------3560------3570------3580------3590----- -3600------3610------3620------3630------3640------3650------3660--- KAAFITYLQAKQAAGIINVPNPGS..PAYVLQIFPPCEFSESHLSRLAPDLLASISNISPHLMIVIAS ||||||||||||||||||||| || |||||||||||||||||||||| ||||||||| |||||||| KAAFITYLQAKQAAGIINVPN.GSNQPAYVLQIFPPCEFSESHLSRLA.DLLASISNI..HLMIVIASV -3600------3610------3620------3630------3640------3650------3660----