1H, 15N and 13C resonance assignments of the conserved domain in the middle of Schizosaccharomyces pombe SAPK-interacting protein 1
GPGHMGSVSN AKAPTSALRA LLEHKENSSQ NGPLAENFAT FSGHAESNAL RLNIYFPSSE SPSKPLFVEL RKNVLVSEAI GYILLQYVNQ QLVPPIEDEA QNPNYWNLRI VEDDGELDED FPALDRVGPL SKFGFDAFAL VKATPAQIKE NQAAYPFKSK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 78.9 % (1466 of 1857) | 77.3 % (748 of 968) | 79.2 % (572 of 722) | 87.4 % (146 of 167) |
Backbone | 90.8 % (848 of 934) | 90.8 % (287 of 316) | 89.6 % (422 of 471) | 94.6 % (139 of 147) |
Sidechain | 70.5 % (757 of 1074) | 70.7 % (461 of 652) | 71.9 % (289 of 402) | 35.0 % (7 of 20) |
Aromatic | 28.6 % (44 of 154) | 42.9 % (33 of 77) | 13.2 % (10 of 76) | 100.0 % (1 of 1) |
Methyl | 83.9 % (141 of 168) | 89.3 % (75 of 84) | 78.6 % (66 of 84) |
1. sin1
GPGHMGSVSN AKAPTSALRA LLEHKENSSQ NGPLAENFAT FSGHAESNAL RLNIYFPSSE SPSKPLFVEL RKNVLVSEAI GYILLQYVNQ QLVPPIEDEA QNPNYWNLRI VEDDGELDED FPALDRVGPL SKFGFDAFAL VKATPAQIKE NQAAYPFKSKSolvent system 90% H2O/10% D2O, Temperature 303 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sin1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | H2O | solvent | 90 % | |
3 | D2O | solvent | 10 % | |
4 | potassium phosphate | buffer | 50 mM | |
5 | potassium chloride | salt | 50 mM | |
6 | DTT | reducing agent | 1 mM |
Solvent system 90% H2O/10% D2O, Temperature 303 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sin1 | natural abundance | protein | 0.5 mM |
8 | H2O | solvent | 90 % | |
9 | D2O | solvent | 10 % | |
10 | potassium phosphate | buffer | 50 mM | |
11 | potassium chloride | salt | 50 mM | |
12 | DTT | reducing agent | 1 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 303 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sin1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | H2O | solvent | 90 % | |
3 | D2O | solvent | 10 % | |
4 | potassium phosphate | buffer | 50 mM | |
5 | potassium chloride | salt | 50 mM | |
6 | DTT | reducing agent | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 303 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sin1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | H2O | solvent | 90 % | |
3 | D2O | solvent | 10 % | |
4 | potassium phosphate | buffer | 50 mM | |
5 | potassium chloride | salt | 50 mM | |
6 | DTT | reducing agent | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 303 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sin1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | H2O | solvent | 90 % | |
3 | D2O | solvent | 10 % | |
4 | potassium phosphate | buffer | 50 mM | |
5 | potassium chloride | salt | 50 mM | |
6 | DTT | reducing agent | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 303 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sin1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | H2O | solvent | 90 % | |
3 | D2O | solvent | 10 % | |
4 | potassium phosphate | buffer | 50 mM | |
5 | potassium chloride | salt | 50 mM | |
6 | DTT | reducing agent | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 303 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sin1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | H2O | solvent | 90 % | |
3 | D2O | solvent | 10 % | |
4 | potassium phosphate | buffer | 50 mM | |
5 | potassium chloride | salt | 50 mM | |
6 | DTT | reducing agent | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 303 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sin1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | H2O | solvent | 90 % | |
3 | D2O | solvent | 10 % | |
4 | potassium phosphate | buffer | 50 mM | |
5 | potassium chloride | salt | 50 mM | |
6 | DTT | reducing agent | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 303 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sin1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | H2O | solvent | 90 % | |
3 | D2O | solvent | 10 % | |
4 | potassium phosphate | buffer | 50 mM | |
5 | potassium chloride | salt | 50 mM | |
6 | DTT | reducing agent | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 303 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sin1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | H2O | solvent | 90 % | |
3 | D2O | solvent | 10 % | |
4 | potassium phosphate | buffer | 50 mM | |
5 | potassium chloride | salt | 50 mM | |
6 | DTT | reducing agent | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 303 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sin1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | H2O | solvent | 90 % | |
3 | D2O | solvent | 10 % | |
4 | potassium phosphate | buffer | 50 mM | |
5 | potassium chloride | salt | 50 mM | |
6 | DTT | reducing agent | 1 mM |
Bruker Avance - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 303 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sin1 | natural abundance | protein | 0.5 mM |
8 | H2O | solvent | 90 % | |
9 | D2O | solvent | 10 % | |
10 | potassium phosphate | buffer | 50 mM | |
11 | potassium chloride | salt | 50 mM | |
12 | DTT | reducing agent | 1 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_11546_2rvk.nef |
Input source #2: Coordindates | 2rvk.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340 GPGHMGSVSNAKAPTSALRALLEHKENSSQNGPLAENFATFSGHAESNALRLNIYFPSSESPSKPLFVELRKNVLVSEAIGYILLQYVNQQLVPPIEDEA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPGHMGSVSNAKAPTSALRALLEHKENSSQNGPLAENFATFSGHAESNALRLNIYFPSSESPSKPLFVELRKNVLVSEAIGYILLQYVNQQLVPPIEDEA --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------350-------360-------370-------380-------390-------400 QNPNYWNLRIVEDDGELDEDFPALDRVGPLSKFGFDAFALVKATPAQIKENQAAYPFKSK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| QNPNYWNLRIVEDDGELDEDFPALDRVGPLSKFGFDAFALVKATPAQIKENQAAYPFKSK -------110-------120-------130-------140-------150-------160
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 160 | 0 | 0 | 100.0 |
Content subtype: combined_11546_2rvk.nef
Assigned chemical shifts
-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340 GPGHMGSVSNAKAPTSALRALLEHKENSSQNGPLAENFATFSGHAESNALRLNIYFPSSESPSKPLFVELRKNVLVSEAIGYILLQYVNQQLVPPIEDEA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||| ....MGSVSNAKAPTSALRALLEHKENSSQNGPLAENFATFSGHAESNALRLNIYFPSSESPSKPLFVELRKNVLVSEAIGYILLQYVNQQLV.PIEDEA -------350-------360-------370-------380-------390-------400 QNPNYWNLRIVEDDGELDEDFPALDRVGPLSKFGFDAFALVKATPAQIKENQAAYPFKSK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| QNPNYWNLRIVEDDGELDEDFPALDRVGPLSKFGFDAFALVKATPAQIKENQAAYPFKSK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 968 | 742 | 76.7 |
13C chemical shifts | 722 | 559 | 77.4 |
15N chemical shifts | 172 | 144 | 83.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 316 | 287 | 90.8 |
13C chemical shifts | 320 | 280 | 87.5 |
15N chemical shifts | 147 | 138 | 93.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 652 | 455 | 69.8 |
13C chemical shifts | 402 | 279 | 69.4 |
15N chemical shifts | 25 | 6 | 24.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 85 | 74 | 87.1 |
13C chemical shifts | 85 | 63 | 74.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 77 | 28 | 36.4 |
13C chemical shifts | 76 | 0 | 0.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340 GPGHMGSVSNAKAPTSALRALLEHKENSSQNGPLAENFATFSGHAESNALRLNIYFPSSESPSKPLFVELRKNVLVSEAIGYILLQYVNQQLVPPIEDEA | |||||||| |||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||| |||||| ...........K...SALRALLE.KENSSQNGPLAENFATFSGHAE.NALRLNIYFPSSESPSKPLFVELRKNVLVSEAIGYILLQYVNQQLV.PIEDEA -------350-------360-------370-------380-------390-------400 QNPNYWNLRIVEDDGELDEDFPALDRVGPLSKFGFDAFALVKATPAQIKENQAAYPFKSK | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Q..NYWNLRIVEDDGELDEDFPALDRVGPLSKFGFDAFALVKATPAQIKENQAAYPFKSK
Dihedral angle restraints
-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340 GPGHMGSVSNAKAPTSALRALLEHKENSSQNGPLAENFATFSGHAESNALRLNIYFPSSESPSKPLFVELRKNVLVSEAIGYILLQYVNQQLVPPIEDEA ||| | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||| .......VSN.............H........PLAENFATFSGHAESNALRLNIYFPSSESPSKPLFVELRKNVLVSEAIGYILLQYVNQQL.PPIEDEA -------350-------360-------370-------380-------390-------400 QNPNYWNLRIVEDDGELDEDFPALDRVGPLSKFGFDAFALVKATPAQIKENQAAYPFKSK | ||||||||||||||||||||||||||||||||||||||||| |||||||||||||||| Q.PNYWNLRIVEDDGELDEDFPALDRVGPLSKFGFDAFALVKA.PAQIKENQAAYPFKSK