DnaT C-terminal domain
MFAMYPDWQP DADFIRLAAL WGVALREPVT TEELASFIAY WQAEGKVFHH VQWQQKLARS LQIGRASNGG LPKRDVNTVS EPDSQIPPGF RGHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 88.7 % (1031 of 1163) | 89.2 % (539 of 604) | 87.3 % (397 of 455) | 91.3 % (95 of 104) |
Backbone | 91.3 % (524 of 574) | 92.9 % (182 of 196) | 89.9 % (258 of 287) | 92.3 % (84 of 91) |
Sidechain | 86.9 % (591 of 680) | 87.5 % (357 of 408) | 86.1 % (223 of 259) | 84.6 % (11 of 13) |
Aromatic | 74.0 % (108 of 146) | 74.0 % (54 of 73) | 72.5 % (50 of 69) | 100.0 % (4 of 4) |
Methyl | 94.7 % (89 of 94) | 100.0 % (47 of 47) | 89.4 % (42 of 47) |
1. DnaT
MFAMYPDWQP DADFIRLAAL WGVALREPVT TEELASFIAY WQAEGKVFHH VQWQQKLARS LQIGRASNGG LPKRDVNTVS EPDSQIPPGF RGHHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DnaT | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
2 | HEPES | natural abundance | 20 mM | |
3 | H2O | solvent | 90 % | |
4 | D2O | solvent | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Varian Unity - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DnaT | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
2 | HEPES | natural abundance | 20 mM | |
3 | H2O | solvent | 90 % | |
4 | D2O | solvent | 10 % |
Varian Unity - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DnaT | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
2 | HEPES | natural abundance | 20 mM | |
3 | H2O | solvent | 90 % | |
4 | D2O | solvent | 10 % |
Varian Unity - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DnaT | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
2 | HEPES | natural abundance | 20 mM | |
3 | H2O | solvent | 90 % | |
4 | D2O | solvent | 10 % |
Varian Unity - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DnaT | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
2 | HEPES | natural abundance | 20 mM | |
3 | H2O | solvent | 90 % | |
4 | D2O | solvent | 10 % |
Varian Unity - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DnaT | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
2 | HEPES | natural abundance | 20 mM | |
3 | H2O | solvent | 90 % | |
4 | D2O | solvent | 10 % |
Varian Unity - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DnaT | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
2 | HEPES | natural abundance | 20 mM | |
3 | H2O | solvent | 90 % | |
4 | D2O | solvent | 10 % |
Varian Unity - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DnaT | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
2 | HEPES | natural abundance | 20 mM | |
3 | H2O | solvent | 90 % | |
4 | D2O | solvent | 10 % |
Varian Unity - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DnaT | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
2 | HEPES | natural abundance | 20 mM | |
3 | H2O | solvent | 90 % | |
4 | D2O | solvent | 10 % |
Varian Unity - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DnaT | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
2 | HEPES | natural abundance | 20 mM | |
3 | H2O | solvent | 90 % | |
4 | D2O | solvent | 10 % |
Varian Unity - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DnaT | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
2 | HEPES | natural abundance | 20 mM | |
3 | H2O | solvent | 90 % | |
4 | D2O | solvent | 10 % |
Varian Unity - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DnaT | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
2 | HEPES | natural abundance | 20 mM | |
3 | H2O | solvent | 90 % | |
4 | D2O | solvent | 10 % |
Varian Unity - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DnaT | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
2 | HEPES | natural abundance | 20 mM | |
3 | H2O | solvent | 90 % | |
4 | D2O | solvent | 10 % |
Varian Unity - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DnaT | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
2 | HEPES | natural abundance | 20 mM | |
3 | H2O | solvent | 90 % | |
4 | D2O | solvent | 10 % |
Varian Unity - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DnaT | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
2 | HEPES | natural abundance | 20 mM | |
3 | H2O | solvent | 90 % | |
4 | D2O | solvent | 10 % |
Varian Unity - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DnaT | [U-99% 13C; U-99% 15N] | protein | 0.5 mM |
2 | HEPES | natural abundance | 20 mM | |
3 | H2O | solvent | 90 % | |
4 | D2O | solvent | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_11549_2ru8.nef |
Input source #2: Coordindates | 2ru8.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--90------100-------110-------120-------130-------140-------150-------160-------170-------180----- MFAMYPDWQPDADFIRLAALWGVALREPVTTEELASFIAYWQAEGKVFHHVQWQQKLARSLQIGRASNGGLPKRDVNTVSEPDSQIPPGFRGHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MFAMYPDWQPDADFIRLAALWGVALREPVTTEELASFIAYWQAEGKVFHHVQWQQKLARSLQIGRASNGGLPKRDVNTVSEPDSQIPPGFRGHHHHHH --------10--------20--------30--------40--------50--------60--------70--------80--------90--------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 98 | 0 | 0 | 100.0 |
Content subtype: combined_11549_2ru8.nef
Assigned chemical shifts
--90------100-------110-------120-------130-------140-------150-------160-------170-------180----- MFAMYPDWQPDADFIRLAALWGVALREPVTTEELASFIAYWQAEGKVFHHVQWQQKLARSLQIGRASNGGLPKRDVNTVSEPDSQIPPGFRGHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||| MFAMYPDWQPDADFIRLAALWGVALREPVTTEELASFIAYWQAEGKVFHHVQWQQKLARSLQIGRASNGGLPKRDVNTVSEPDSQI.PGFRG --90------100-------110-------120-------130-------140-------150-------160-------170---------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 604 | 535 | 88.6 |
13C chemical shifts | 455 | 397 | 87.3 |
15N chemical shifts | 110 | 93 | 84.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 196 | 182 | 92.9 |
13C chemical shifts | 196 | 174 | 88.8 |
15N chemical shifts | 91 | 84 | 92.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 408 | 353 | 86.5 |
13C chemical shifts | 259 | 223 | 86.1 |
15N chemical shifts | 19 | 9 | 47.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 49 | 49 | 100.0 |
13C chemical shifts | 49 | 43 | 87.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 73 | 54 | 74.0 |
13C chemical shifts | 69 | 50 | 72.5 |
15N chemical shifts | 4 | 4 | 100.0 |
Distance restraints
--90------100-------110-------120-------130-------140-------150-------160-------170-------180----- MFAMYPDWQPDADFIRLAALWGVALREPVTTEELASFIAYWQAEGKVFHHVQWQQKLARSLQIGRASNGGLPKRDVNTVSEPDSQIPPGFRGHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||| || MFAMYPDWQPDADFIRLAALWGVALREPVTTEELASFIAYWQAEGKVFHHVQWQQKLARSLQIGRAS.GGLPKRDVNTVSEPDSQI...FR --90------100-------110-------120-------130-------140-------150-------160-------170--------
Dihedral angle restraints
--90------100-------110-------120-------130-------140-------150-------160-------170-------180----- MFAMYPDWQPDADFIRLAALWGVALREPVTTEELASFIAYWQAEGKVFHHVQWQQKLARSLQIGRASNGGLPKRDVNTVSEPDSQIPPGFRGHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||| .FAMYPDWQPDADFIRLAALWGVALREPVTTEELASFIAYWQAEGKVFHHVQWQQKLARSLQIGRASN.....RDV --90------100-------110-------120-------130-------140-------150-------160---