Solution Structure of the Bacillus anthracis Sortase A-substrate Complex
GSHMDASKID QPDLAEVANA SLDKKQVIGR ISIPSVSLEL PVLKSSTEKN LLSGAATVKE NQVMGKGNYA LAGHNMSKKG VLFSDIASLK KGDKIYLYDN ENEYEYAVTG VSEVTPDKWE VVEDHGKDEI TLITCVSVKD NSKRYVVAGD LVGTKAKK
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS135:SG | 2:B275:CYS |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 88.9 % (1617 of 1818) | 87.4 % (822 of 941) | 90.6 % (642 of 709) | 91.1 % (153 of 168) |
Backbone | 94.1 % (900 of 956) | 94.5 % (311 of 329) | 94.3 % (444 of 471) | 92.9 % (145 of 156) |
Sidechain | 85.0 % (859 of 1011) | 83.5 % (511 of 612) | 87.9 % (340 of 387) | 66.7 % (8 of 12) |
Aromatic | 57.3 % (47 of 82) | 58.5 % (24 of 41) | 57.5 % (23 of 40) | 0.0 % (0 of 1) |
Methyl | 93.9 % (184 of 196) | 95.9 % (94 of 98) | 91.8 % (90 of 98) |
1. BaSrtA
GSHMDASKID QPDLAEVANA SLDKKQVIGR ISIPSVSLEL PVLKSSTEKN LLSGAATVKE NQVMGKGNYA LAGHNMSKKG VLFSDIASLK KGDKIYLYDN ENEYEYAVTG VSEVTPDKWE VVEDHGKDEI TLITCVSVKD NSKRYVVAGD LVGTKAKK2. Boc-LPAT*
XLPAXSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BaSrtA | [U-100% 13C; U-100% 15N] | protein | 2.6 mM |
2 | Boc-LPAT | natural abundance | 2.6 mM | |
3 | sodium phosphate | natural abundance | buffer | 50 mM |
4 | sodium azide | natural abundance | 0.01 % | |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | BaSrtA | [U-100% 13C; U-100% 15N] | protein | 2.6 mM |
8 | Boc-LPAT | natural abundance | 2.6 mM | |
9 | sodium phosphate | natural abundance | buffer | 50 mM |
10 | sodium azide | natural abundance | 0.01 % | |
11 | D2O | [U-2H] | solvent | 100 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BaSrtA | [U-100% 13C; U-100% 15N] | protein | 2.6 mM |
2 | Boc-LPAT | natural abundance | 2.6 mM | |
3 | sodium phosphate | natural abundance | buffer | 50 mM |
4 | sodium azide | natural abundance | 0.01 % | |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | BaSrtA | [U-100% 13C; U-100% 15N] | protein | 2.6 mM |
8 | Boc-LPAT | natural abundance | 2.6 mM | |
9 | sodium phosphate | natural abundance | buffer | 50 mM |
10 | sodium azide | natural abundance | 0.01 % | |
11 | D2O | [U-2H] | solvent | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BaSrtA | [U-100% 13C; U-100% 15N] | protein | 2.6 mM |
2 | Boc-LPAT | natural abundance | 2.6 mM | |
3 | sodium phosphate | natural abundance | buffer | 50 mM |
4 | sodium azide | natural abundance | 0.01 % | |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BaSrtA | [U-100% 13C; U-100% 15N] | protein | 2.6 mM |
2 | Boc-LPAT | natural abundance | 2.6 mM | |
3 | sodium phosphate | natural abundance | buffer | 50 mM |
4 | sodium azide | natural abundance | 0.01 % | |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BaSrtA | [U-100% 13C; U-100% 15N] | protein | 2.6 mM |
2 | Boc-LPAT | natural abundance | 2.6 mM | |
3 | sodium phosphate | natural abundance | buffer | 50 mM |
4 | sodium azide | natural abundance | 0.01 % | |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BaSrtA | [U-100% 13C; U-100% 15N] | protein | 2.6 mM |
2 | Boc-LPAT | natural abundance | 2.6 mM | |
3 | sodium phosphate | natural abundance | buffer | 50 mM |
4 | sodium azide | natural abundance | 0.01 % | |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BaSrtA | [U-100% 13C; U-100% 15N] | protein | 2.6 mM |
2 | Boc-LPAT | natural abundance | 2.6 mM | |
3 | sodium phosphate | natural abundance | buffer | 50 mM |
4 | sodium azide | natural abundance | 0.01 % | |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | BaSrtA | [U-100% 13C; U-100% 15N] | protein | 2.6 mM |
8 | Boc-LPAT | natural abundance | 2.6 mM | |
9 | sodium phosphate | natural abundance | buffer | 50 mM |
10 | sodium azide | natural abundance | 0.01 % | |
11 | D2O | [U-2H] | solvent | 100 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BaSrtA | [U-100% 13C; U-100% 15N] | protein | 2.6 mM |
2 | Boc-LPAT | natural abundance | 2.6 mM | |
3 | sodium phosphate | natural abundance | buffer | 50 mM |
4 | sodium azide | natural abundance | 0.01 % | |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BaSrtA | [U-100% 13C; U-100% 15N] | protein | 2.6 mM |
2 | Boc-LPAT | natural abundance | 2.6 mM | |
3 | sodium phosphate | natural abundance | buffer | 50 mM |
4 | sodium azide | natural abundance | 0.01 % | |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | BaSrtA | [U-100% 13C; U-100% 15N] | protein | 2.6 mM |
8 | Boc-LPAT | natural abundance | 2.6 mM | |
9 | sodium phosphate | natural abundance | buffer | 50 mM |
10 | sodium azide | natural abundance | 0.01 % | |
11 | D2O | [U-2H] | solvent | 100 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BaSrtA | [U-100% 13C; U-100% 15N] | protein | 2.6 mM |
2 | Boc-LPAT | natural abundance | 2.6 mM | |
3 | sodium phosphate | natural abundance | buffer | 50 mM |
4 | sodium azide | natural abundance | 0.01 % | |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | BaSrtA | [U-100% 13C; U-100% 15N] | protein | 2.6 mM |
8 | Boc-LPAT | natural abundance | 2.6 mM | |
9 | sodium phosphate | natural abundance | buffer | 50 mM |
10 | sodium azide | natural abundance | 0.01 % | |
11 | D2O | [U-2H] | solvent | 100 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BaSrtA | [U-100% 13C; U-100% 15N] | protein | 2.6 mM |
2 | Boc-LPAT | natural abundance | 2.6 mM | |
3 | sodium phosphate | natural abundance | buffer | 50 mM |
4 | sodium azide | natural abundance | 0.01 % | |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BaSrtA | [U-100% 13C; U-100% 15N] | protein | 2.6 mM |
2 | Boc-LPAT | natural abundance | 2.6 mM | |
3 | sodium phosphate | natural abundance | buffer | 50 mM |
4 | sodium azide | natural abundance | 0.01 % | |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_11570_2rui.nef |
Input source #2: Coordindates | 2rui.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
1:135:CYS:SG | 2:5:B27:SG | unknown | unknown | n/a |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
2:1:BOC:C | 2:2:LEU:N | unknown | unknown | n/a |
2:4:ALA:C | 2:5:B27:N | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 701 | BOC | TERT-BUTYL HYDROGEN CARBONATE | Coordinates |
B | 705 | B27 | (2R,3S) 3-amino-4-mercapto-2-butanol | Assigned chemical shifts, Coordinates |
Sequence alignments
------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-- GSHMDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDN --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -----160-------170-------180-------190-------200-------210 ENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK -------110-------120-------130-------140-------150--------
----- XLPAX ||||| XLPAX
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 158 | 0 | 0 | 100.0 |
B | B | 5 | 0 | 0 | 100.0 |
Content subtype: combined_11570_2rui.nef
Assigned chemical shifts
------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-- GSHMDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDN ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||| ...MDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGH.MSKKGVLFSDIASLKKGDKIYLYDN -----160-------170-------180-------190-------200-------210 ENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK |||||||||||||||||||||||||||||||||| ||||||||||||||||||||||| ENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLIT.VSVKDNSKRYVVAGDLVGTKAKK
----- XLPAX |||| .LPAX
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
71 | ASN | CG | 176.896 |
82 | ARG | CZ | 159.208 |
102 | ASN | CG | 174.468 |
113 | ASN | CG | 177.966 |
120 | ASN | CG | 176.894 |
152 | ASN | CG | 177.24 |
154 | ASN | CG | 175.517 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 924 | 796 | 86.1 |
13C chemical shifts | 695 | 635 | 91.4 |
15N chemical shifts | 168 | 152 | 90.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 324 | 305 | 94.1 |
13C chemical shifts | 316 | 298 | 94.3 |
15N chemical shifts | 154 | 143 | 92.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 600 | 491 | 81.8 |
13C chemical shifts | 379 | 337 | 88.9 |
15N chemical shifts | 14 | 9 | 64.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 98 | 92 | 93.9 |
13C chemical shifts | 98 | 92 | 93.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 41 | 24 | 58.5 |
13C chemical shifts | 40 | 23 | 57.5 |
15N chemical shifts | 1 | 0 | 0.0 |
Comp_index_ID | Comp_ID |
---|---|
701 | BOC |
705 | B27 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 17 | 14 | 82.4 |
13C chemical shifts | 14 | 0 | 0.0 |
15N chemical shifts | 2 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 5 | 3 | 60.0 |
13C chemical shifts | 6 | 0 | 0.0 |
15N chemical shifts | 2 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 12 | 11 | 91.7 |
13C chemical shifts | 8 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 3 | 3 | 100.0 |
13C chemical shifts | 3 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|
Covalent bonds
Distance restraints
------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-- GSHMDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDN ||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||| ||||||||||||||||||||||||| ...MDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLK.STEKNLLSGAATVKENQVMGKGNYALAGH.MSKKGVLFSDIASLKKGDKIYLYDN -----160-------170-------180-------190-------200-------210 ENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK |||||||||||||||||||||||||||||||||| ||||| |||||||||||||||| ENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLIT.VSVKD..KRYVVAGDLVGTKAKK
Dihedral angle restraints
------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-- GSHMDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..HMDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDN -----160-------170-------180-------190-------200-------210 ENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK
RDC restraints
------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-- GSHMDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDN |||||||| |||| ||| || ||||||||||| || |||| ||| |||||||||||| ||| |||||||| |||||||||||||| ...MDASKIDQ..LAEV.NAS..KK....RISIPSVSLEL.VL..STEK..LSG...VKENQVMGKGNY.LAG....KKGVLFSD.ASLKKGDKIYLYDN -----160-------170-------180-------190-------200-------210 ENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK ||||||||||||| || || |||||||||| | |||||||||||| ENEYEYAVTGVSE...DK...VE.HGKDEITLIT....K.......VAGDLVGTKAKK