BMRBj - BMREntryMaster

	Total	¹H	¹³C	¹⁵N
All	97.8 % (1315 of 1345)	98.3 % (695 of 707)	97.5 % (504 of 517)	95.9 % (116 of 121)
Backbone	96.5 % (670 of 694)	97.1 % (232 of 239)	96.5 % (330 of 342)	95.6 % (108 of 113)
Sidechain	98.9 % (751 of 759)	98.9 % (463 of 468)	98.9 % (280 of 283)	100.0 % (8 of 8)
Aromatic	99.0 % (95 of 96)	100.0 % (48 of 48)	97.9 % (46 of 47)	100.0 % (1 of 1)
Methyl	99.0 % (99 of 100)	98.0 % (49 of 50)	100.0 % (50 of 50)

1. entity

GSHMEPARVR CSHLLVKHSQ SRRPSSWRQE KITRTKEEAL ELINGYIQKI KSGEEDFESL ASQFSDASSA KARGDLGAFS RGQMQKPFED ASFALRTGEM SGPVFTDSGI HIILRTE

Show sample condition

Sample

Solvent system 94% H2O/6% D2O, Pressure 1 atm, Temperature 299 K, pH 6.6

#	Name	Isotope labeling	Type	Concentration
1	sodium sulfate	natural abundance	salt	100 mM
2	sodium phosphate	natural abundance	buffer	50 mM
3	EDTA	natural abundance		5 mM
4	D2O	[U-2H]	solvent	6 %
5	H2O	natural abundance	solvent	94 %
6	DTT	natural abundance		1 mM
7	NaN3	natural abundance		0.03 %

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	external	indirect	0.2514495
¹H	DSS	methyl protons	external	direct	1.0
¹⁵N	DSS	methyl protons	external	indirect	0.1013291

Referencing offset: -0.46 ppm, Outliers: 3 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	external	indirect	0.2514495
¹H	DSS	methyl protons	external	direct	1.0
¹⁵N	DSS	methyl protons	external	indirect	0.1013291

Referencing offset: -0.46 ppm, Outliers: 3 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	external	indirect	0.2514495
¹H	DSS	methyl protons	external	direct	1.0
¹⁵N	DSS	methyl protons	external	indirect	0.1013291

Referencing offset: -0.01 ppm, Outliers: 4 Detail

LACS Plot; CO

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	external	indirect	0.2514495
¹H	DSS	methyl protons	external	direct	1.0
¹⁵N	DSS	methyl protons	external	indirect	0.1013291

Referencing offset: -0.27 ppm, Outliers: 3 Detail

Protein Blocks Logo

Calculated from 10 models in PDB: 2RUQ, Strand ID: A Detail

Release date

2016-01-03

Citation

Allosteric Breakage of the Hydrogen Bond within the Dual-Histidine Motif in the Active Site of Human Pin1 PPIase
Wang, J., Tochio, N., Kawasaki, R., Tamari, Y., Xu, N., Uewaki, J., Utsunomiya-Tate, N., Tate, S.
Biochemistry (2015), 54, 5242-5253, PubMed 26226559 , DOI 10.1021/acs.biochem.5b00606 , Abstract

Related entities 1. Human Pin PPIase C113A mutant, : 1 : 1 : 56 : 121 entities Detail

Interaction partners 1. Human Pin PPIase C113A mutant, : 141 interactors Detail

More details for 141 interactors identified by 38 citations

Experiments performed 2 experiments Detail

NMR combined restraints 4 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_11587_2ruq.nef
Input source #2: Coordindates	2ruq.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
GSHMEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDASSAKARGDLGAFSRGQMQKPFEDASFALRTGEM
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
GSHMEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDASSAKARGDLGAFSRGQMQKPFEDASFALRTGEM

-------110-------
SGPVFTDSGIHIILRTE
|||||||||||||||||
SGPVFTDSGIHIILRTE

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	117	0	0	100.0

Content subtype: combined_11587_2ruq.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	1327		98.3 (chain: A, length: 117)
1	Distance restraints	CNS/XPLOR_distance_constraints_3	OK	3993 (1)	noe	97.4 (chain: A, length: 117)
1	Dihedral angle restraints	CNS/XPLOR_dihedral_2	OK	104 (104)	.	61.5 (chain: A, length: 117)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 117, Sequence coverage: 98.3%
- Total number of assignments
  - ¹H chemical shifts: 697
  - ¹³C chemical shifts: 505
  - ¹⁵N chemical shifts: 125
- Completeness of assignments
  - Entity_assemble_ID: A
- Redox state of CYS
- Peptide bond of PRO
- Tautomeric state of HIS
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	707	697	98.6
¹³C chemical shifts	517	505	97.7
¹⁵N chemical shifts	131	125	95.4

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	239	232	97.1
¹³C chemical shifts	234	225	96.2
¹⁵N chemical shifts	113	107	94.7

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	468	465	99.4
¹³C chemical shifts	283	280	98.9
¹⁵N chemical shifts	18	18	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	53	53	100.0
¹³C chemical shifts	53	53	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	48	48	100.0
¹³C chemical shifts	47	46	97.9
¹⁵N chemical shifts	1	1	100.0

Distance restraints

Saveframe: CNS/XPLOR_distance_constraints_3
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 117, Sequence coverage: 97.4%
- Total number of restraints: 3835
- Weight of restraints: 1.0 (3835)
- Potential type of restraints: square-well-parabolic (3835)
- Range of distance target values: 2.6, 6.9 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map

Dihedral angle restraints

Saveframe: CNS/XPLOR_dihedral_2
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 117, Sequence coverage: 61.5%
- Total number of restraints: 104
- Total number of restraints per polymer type: 104
- Weight of restraints: 1.0 (104)
- Potential type of restraints: square-well-parabolic (104)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

Keywords Cys-113 mutation, Human Pin1 PPIase

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (2.463 seconds)

BMRB: 11587

Sample

Chemical shift reference

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. Human Pin PPIase C113A mutant, : 1 : 1 : 56 : 121 entities Detail

Interaction partners 1. Human Pin PPIase C113A mutant, : 141 interactors Detail

Experiments performed 2 experiments Detail

Instrument

Sample

Instrument

Sample

NMR combined restraints 4 contents Detail