Solution Structure of the PhoP DNA-Binding Domain from Mycobacterium tuberculosis
MGSSHHHHHH SSGLVPRGSH MKGNKEPRNV RLTFADIELD EETHEVWKAG QPVSLSPTEF TLLRYFVINA GTVLSKPKIL DHVWRYDFGG DVNVVESYVS YLRRKIDTGE KRLLHTLRGV GYVLREPR
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 75.5 % (1140 of 1510) | 72.0 % (565 of 785) | 79.4 % (473 of 596) | 79.1 % (102 of 129) |
Backbone | 83.5 % (631 of 756) | 83.1 % (217 of 261) | 84.2 % (314 of 373) | 82.0 % (100 of 122) |
Sidechain | 70.1 % (611 of 871) | 66.4 % (348 of 524) | 76.8 % (261 of 340) | 28.6 % (2 of 7) |
Aromatic | 36.8 % (53 of 144) | 37.5 % (27 of 72) | 34.3 % (24 of 70) | 100.0 % (2 of 2) |
Methyl | 97.1 % (136 of 140) | 97.1 % (68 of 70) | 97.1 % (68 of 70) |
1. PhoPC
MGSSHHHHHH SSGLVPRGSH MKGNKEPRNV RLTFADIELD EETHEVWKAG QPVSLSPTEF TLLRYFVINA GTVLSKPKIL DHVWRYDFGG DVNVVESYVS YLRRKIDTGE KRLLHTLRGV GYVLREPRSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | buffer | 50.0 mM |
2 | sodium chloride | natural abundance | salt | 300.0 mM |
3 | sodium azide | natural abundance | 0.01 % | |
4 | PhoPC | [U-100% 13C; U-100% 15N] | protein | 1.0 (±0.5) mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | buffer | 50.0 mM |
8 | sodium chloride | natural abundance | salt | 300.0 mM |
9 | sodium azide | natural abundance | 0.01 % | |
10 | PhoPC | [U-100% 13C; U-100% 15N] | protein | 1.0 (±0.5) mM |
11 | D2O | [U-2H] | solvent | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avence - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | buffer | 50.0 mM |
2 | sodium chloride | natural abundance | salt | 300.0 mM |
3 | sodium azide | natural abundance | 0.01 % | |
4 | PhoPC | [U-100% 13C; U-100% 15N] | protein | 1.0 (±0.5) mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker Avence - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | buffer | 50.0 mM |
8 | sodium chloride | natural abundance | salt | 300.0 mM |
9 | sodium azide | natural abundance | 0.01 % | |
10 | PhoPC | [U-100% 13C; U-100% 15N] | protein | 1.0 (±0.5) mM |
11 | D2O | [U-2H] | solvent | 100 % |
Bruker Avence - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | buffer | 50.0 mM |
8 | sodium chloride | natural abundance | salt | 300.0 mM |
9 | sodium azide | natural abundance | 0.01 % | |
10 | PhoPC | [U-100% 13C; U-100% 15N] | protein | 1.0 (±0.5) mM |
11 | D2O | [U-2H] | solvent | 100 % |
Bruker Avence - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | buffer | 50.0 mM |
2 | sodium chloride | natural abundance | salt | 300.0 mM |
3 | sodium azide | natural abundance | 0.01 % | |
4 | PhoPC | [U-100% 13C; U-100% 15N] | protein | 1.0 (±0.5) mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker Avence - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | buffer | 50.0 mM |
2 | sodium chloride | natural abundance | salt | 300.0 mM |
3 | sodium azide | natural abundance | 0.01 % | |
4 | PhoPC | [U-100% 13C; U-100% 15N] | protein | 1.0 (±0.5) mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker Avence - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | buffer | 50.0 mM |
2 | sodium chloride | natural abundance | salt | 300.0 mM |
3 | sodium azide | natural abundance | 0.01 % | |
4 | PhoPC | [U-100% 13C; U-100% 15N] | protein | 1.0 (±0.5) mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker Avence - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | buffer | 50.0 mM |
2 | sodium chloride | natural abundance | salt | 300.0 mM |
3 | sodium azide | natural abundance | 0.01 % | |
4 | PhoPC | [U-100% 13C; U-100% 15N] | protein | 1.0 (±0.5) mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker Avence - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | buffer | 50.0 mM |
2 | sodium chloride | natural abundance | salt | 300.0 mM |
3 | sodium azide | natural abundance | 0.01 % | |
4 | PhoPC | [U-100% 13C; U-100% 15N] | protein | 1.0 (±0.5) mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker Avence - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | buffer | 50.0 mM |
2 | sodium chloride | natural abundance | salt | 300.0 mM |
3 | sodium azide | natural abundance | 0.01 % | |
4 | PhoPC | [U-100% 13C; U-100% 15N] | protein | 1.0 (±0.5) mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker Avence - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | buffer | 50.0 mM |
2 | sodium chloride | natural abundance | salt | 300.0 mM |
3 | sodium azide | natural abundance | 0.01 % | |
4 | PhoPC | [U-100% 13C; U-100% 15N] | protein | 1.0 (±0.5) mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker Avence - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | buffer | 50.0 mM |
2 | sodium chloride | natural abundance | salt | 300.0 mM |
3 | sodium azide | natural abundance | 0.01 % | |
4 | PhoPC | [U-100% 13C; U-100% 15N] | protein | 1.0 (±0.5) mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker Avence - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | buffer | 50.0 mM |
8 | sodium chloride | natural abundance | salt | 300.0 mM |
9 | sodium azide | natural abundance | 0.01 % | |
10 | PhoPC | [U-100% 13C; U-100% 15N] | protein | 1.0 (±0.5) mM |
11 | D2O | [U-2H] | solvent | 100 % |
Bruker Avence - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | buffer | 50.0 mM |
8 | sodium chloride | natural abundance | salt | 300.0 mM |
9 | sodium azide | natural abundance | 0.01 % | |
10 | PhoPC | [U-100% 13C; U-100% 15N] | protein | 1.0 (±0.5) mM |
11 | D2O | [U-2H] | solvent | 100 % |
Bruker Avence - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | buffer | 50.0 mM |
8 | sodium chloride | natural abundance | salt | 300.0 mM |
9 | sodium azide | natural abundance | 0.01 % | |
10 | PhoPC | [U-100% 13C; U-100% 15N] | protein | 1.0 (±0.5) mM |
11 | D2O | [U-2H] | solvent | 100 % |
Bruker Avence - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | buffer | 50.0 mM |
2 | sodium chloride | natural abundance | salt | 300.0 mM |
3 | sodium azide | natural abundance | 0.01 % | |
4 | PhoPC | [U-100% 13C; U-100% 15N] | protein | 1.0 (±0.5) mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker Avence - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | buffer | 50.0 mM |
8 | sodium chloride | natural abundance | salt | 300.0 mM |
9 | sodium azide | natural abundance | 0.01 % | |
10 | PhoPC | [U-100% 13C; U-100% 15N] | protein | 1.0 (±0.5) mM |
11 | D2O | [U-2H] | solvent | 100 % |
Bruker Avence - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | buffer | 50.0 mM |
2 | sodium chloride | natural abundance | salt | 300.0 mM |
3 | sodium azide | natural abundance | 0.01 % | |
4 | PhoPC | [U-100% 13C; U-100% 15N] | protein | 1.0 (±0.5) mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker Avence - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | buffer | 50.0 mM |
2 | sodium chloride | natural abundance | salt | 300.0 mM |
3 | sodium azide | natural abundance | 0.01 % | |
4 | PhoPC | [U-100% 13C; U-100% 15N] | protein | 1.0 (±0.5) mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker Avence - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | buffer | 50.0 mM |
2 | sodium chloride | natural abundance | salt | 300.0 mM |
3 | sodium azide | natural abundance | 0.01 % | |
4 | PhoPC | [U-100% 13C; U-100% 15N] | protein | 1.0 (±0.5) mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker Avence - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | buffer | 50.0 mM |
8 | sodium chloride | natural abundance | salt | 300.0 mM |
9 | sodium azide | natural abundance | 0.01 % | |
10 | PhoPC | [U-100% 13C; U-100% 15N] | protein | 1.0 (±0.5) mM |
11 | D2O | [U-2H] | solvent | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_11590_2rv8.nef |
Input source #2: Coordindates | 2rv8.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
120-----130-------140-------150-------160-------170-------180-------190-------200-------210-------22 MGSSHHHHHHSSGLVPRGSHMKGNKEPRNVRLTFADIELDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVWRYDFGGDVNVVESYVS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHHHHHHSSGLVPRGSHMKGNKEPRNVRLTFADIELDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVWRYDFGGDVNVVESYVS --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 0-------230-------240------- YLRRKIDTGEKRLLHTLRGVGYVLREPR |||||||||||||||||||||||||||| YLRRKIDTGEKRLLHTLRGVGYVLREPR -------110-------120--------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 128 | 0 | 0 | 100.0 |
Content subtype: combined_11590_2rv8.nef
Assigned chemical shifts
120-----130-------140-------150-------160-------170-------180-------190-------200-------210-------22 MGSSHHHHHHSSGLVPRGSHMKGNKEPRNVRLTFADIELDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVWRYDFGGDVNVVESYVS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......................GNKEPRNVRLTFADIELDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVWRYDFGGDVNVVESYVS 0-------230-------240------- YLRRKIDTGEKRLLHTLRGVGYVLREPR ||||||||||||||||| |||||||||| YLRRKIDTGEKRLLHTL.GVGYVLREPR
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 785 | 541 | 68.9 |
13C chemical shifts | 596 | 453 | 76.0 |
15N chemical shifts | 140 | 98 | 70.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 261 | 209 | 80.1 |
13C chemical shifts | 256 | 204 | 79.7 |
15N chemical shifts | 122 | 96 | 78.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 524 | 332 | 63.4 |
13C chemical shifts | 340 | 249 | 73.2 |
15N chemical shifts | 18 | 2 | 11.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 72 | 66 | 91.7 |
13C chemical shifts | 72 | 66 | 91.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 72 | 28 | 38.9 |
13C chemical shifts | 70 | 24 | 34.3 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
120-----130-------140-------150-------160-------170-------180-------190-------200-------210-------22 MGSSHHHHHHSSGLVPRGSHMKGNKEPRNVRLTFADIELDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVWRYDFGGDVNVVESYVS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ............................NVRLTFADIELDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVWRYDFGGDVNVVESYVS 120-----130-------140-------150-------160-------170-------180-------190-------200-------210-------22 0-------230-------240------- YLRRKIDTGEKRLLHTLRGVGYVLREPR ||||||||||||||||| ||||||||| YLRRKIDTGEKRLLHTL.GVGYVLREP 0-------230-------240------
Dihedral angle restraints
120-----130-------140-------150-------160-------170-------180-------190-------200-------210-------22 MGSSHHHHHHSSGLVPRGSHMKGNKEPRNVRLTFADIELDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVWRYDFGGDVNVVESYVS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ............................NVRLTFADIELDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVWRYDFGGDVNVVESYVS 0-------230-------240------- YLRRKIDTGEKRLLHTLRGVGYVLREPR |||||||||||||||||||||||||||| YLRRKIDTGEKRLLHTLRGVGYVLREPR