Solution structure of chitosan-binding module 1 derived from chitosanase/glucanase from Paenibacillus sp. IK-5
NLALNKTATA SSIEGAGFEA SRAFDGSSTT RWASAEGVDP QWIYVNLGSS QTVNRVKLNW EAAYASSYTI QVSNDSGTPT NWTTVYTTTT GDGGIDDITF TARTAKYVRV HGTVRGTPYG YSLWEFEVYG
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.3 % (1194 of 1416) | 82.9 % (591 of 713) | 82.4 % (462 of 561) | 99.3 % (141 of 142) |
Backbone | 98.8 % (765 of 774) | 98.5 % (266 of 270) | 98.9 % (373 of 377) | 99.2 % (126 of 127) |
Sidechain | 71.7 % (544 of 759) | 73.4 % (325 of 443) | 67.8 % (204 of 301) | 100.0 % (15 of 15) |
Aromatic | 26.8 % (45 of 168) | 32.1 % (27 of 84) | 16.5 % (13 of 79) | 100.0 % (5 of 5) |
Methyl | 87.5 % (126 of 144) | 88.9 % (64 of 72) | 86.1 % (62 of 72) |
1. DD1
NLALNKTATA SSIEGAGFEA SRAFDGSSTT RWASAEGVDP QWIYVNLGSS QTVNRVKLNW EAAYASSYTI QVSNDSGTPT NWTTVYTTTT GDGGIDDITF TARTAKYVRV HGTVRGTPYG YSLWEFEVYGSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DD1 | [U-95% 13C; U-95% 15N] | protein | 0.4 mM |
2 | TRIS | natural abundance | buffer | 10 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | DD1 | [U-95% 13C; U-95% 15N] | protein | 0.4 mM |
6 | D2O | [U-2H] | solvent | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DD1 | [U-95% 13C; U-95% 15N] | protein | 0.4 mM |
2 | TRIS | natural abundance | buffer | 10 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DD1 | [U-95% 13C; U-95% 15N] | protein | 0.4 mM |
2 | TRIS | natural abundance | buffer | 10 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DD1 | [U-95% 13C; U-95% 15N] | protein | 0.4 mM |
2 | TRIS | natural abundance | buffer | 10 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DD1 | [U-95% 13C; U-95% 15N] | protein | 0.4 mM |
2 | TRIS | natural abundance | buffer | 10 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DD1 | [U-95% 13C; U-95% 15N] | protein | 0.4 mM |
2 | TRIS | natural abundance | buffer | 10 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DD1 | [U-95% 13C; U-95% 15N] | protein | 0.4 mM |
2 | TRIS | natural abundance | buffer | 10 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DD1 | [U-95% 13C; U-95% 15N] | protein | 0.4 mM |
2 | TRIS | natural abundance | buffer | 10 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | DD1 | [U-95% 13C; U-95% 15N] | protein | 0.4 mM |
6 | D2O | [U-2H] | solvent | 100 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | DD1 | [U-95% 13C; U-95% 15N] | protein | 0.4 mM |
6 | D2O | [U-2H] | solvent | 100 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | DD1 | [U-95% 13C; U-95% 15N] | protein | 0.4 mM |
6 | D2O | [U-2H] | solvent | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_11591_2rv9.nef |
Input source #2: Coordindates | 2rv9.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------------10--------20--------30--------40--------50--------60--------70--------80--------90---- HHHHHHNLALNKTATASSIEGAGFEASRAFDGSSTTRWASAEGVDPQWIYVNLGSSQTVNRVKLNWEAAYASSYTIQVSNDSGTPTNWTTVYTTTTGDGG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| HHHHHHNLALNKTATASSIEGAGFEASRAFDGSSTTRWASAEGVDPQWIYVNLGSSQTVNRVKLNWEAAYASSYTIQVSNDSGTPTNWTTVYTTTTGDGG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ---100-------110-------120-------130 IDDITFTARTAKYVRVHGTVRGTPYGYSLWEFEVYG |||||||||||||||||||||||||||||||||||| IDDITFTARTAKYVRVHGTVRGTPYGYSLWEFEVYG -------110-------120-------130------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 136 | 0 | 0 | 100.0 |
Content subtype: combined_11591_2rv9.nef
Assigned chemical shifts
--------------10--------20--------30--------40--------50--------60--------70--------80--------90---- HHHHHHNLALNKTATASSIEGAGFEASRAFDGSSTTRWASAEGVDPQWIYVNLGSSQTVNRVKLNWEAAYASSYTIQVSNDSGTPTNWTTVYTTTTGDGG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......NLALNKTATASSIEGAGFEASRAFDGSSTTRWASAEGVDPQWIYVNLGSSQTVNRVKLNWEAAYASSYTIQVSNDSGTPTNWTTVYTTTTGDGG ---100-------110-------120-------130 IDDITFTARTAKYVRVHGTVRGTPYGYSLWEFEVYG |||||||||||||||||||||||||||||||||||| IDDITFTARTAKYVRVHGTVRGTPYGYSLWEFEVYG
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 749 | 550 | 73.4 |
13C chemical shifts | 591 | 457 | 77.3 |
15N chemical shifts | 154 | 140 | 90.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 282 | 262 | 92.9 |
13C chemical shifts | 272 | 259 | 95.2 |
15N chemical shifts | 133 | 126 | 94.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 467 | 288 | 61.7 |
13C chemical shifts | 319 | 198 | 62.1 |
15N chemical shifts | 21 | 14 | 66.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 72 | 63 | 87.5 |
13C chemical shifts | 72 | 62 | 86.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 96 | 21 | 21.9 |
13C chemical shifts | 91 | 13 | 14.3 |
15N chemical shifts | 5 | 5 | 100.0 |
Distance restraints
--------------10--------20--------30--------40--------50--------60--------70--------80--------90---- HHHHHHNLALNKTATASSIEGAGFEASRAFDGSSTTRWASAEGVDPQWIYVNLGSSQTVNRVKLNWEAAYASSYTIQVSNDSGTPTNWTTVYTTTTGDGG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||| | ......NLALNKTATASSIEGAGFEASRAFDGSSTTRWASAEGVDPQWIYVNLGSSQTVNRVKLNWEAAYASSYTIQVSNDS.TPTNWTTVYTTTTGD.G ---100-------110-------120-------130 IDDITFTARTAKYVRVHGTVRGTPYGYSLWEFEVYG |||||||||||||||||||||||||||||||||||| IDDITFTARTAKYVRVHGTVRGTPYGYSLWEFEVYG
--------------10--------20--------30--------40--------50--------60--------70--------80--------90---- HHHHHHNLALNKTATASSIEGAGFEASRAFDGSSTTRWASAEGVDPQWIYVNLGSSQTVNRVKLNWEAAYASSYTIQVSNDSGTPTNWTTVYTTTTGDGG |||||||| ||||||||||| |||||||||||||||||||||||||||||| || | |||||| || ||||||| || |||||| || ......NLALNKTA.ASSIEGAGFEA.RAFDGSSTTRWASAEGVDPQWIYVNLGSSQ.VN.V.LNWEAA..SS..IQVSNDS.TP.NWTTVY....GD.. --------------10--------20--------30--------40--------50--------60--------70--------80--------90---- ---100-------110-------120-------130 IDDITFTARTAKYVRVHGTVRGTPYGYSLWEFEVYG |||| |||| ||||||| |||||||||||||||| IDDI.FTAR.AKYVRVH..VRGTPYGYSLWEFEVY ---100-------110-------120---------
Dihedral angle restraints
--------------10--------20--------30--------40--------50--------60--------70--------80--------90---- HHHHHHNLALNKTATASSIEGAGFEASRAFDGSSTTRWASAEGVDPQWIYVNLGSSQTVNRVKLNWEAAYASSYTIQVSNDSGTPTNWTTVYTTTTGDGG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....HNLALNKTATASSIEGAGFEASRAFDGSSTTRWASAEGVDPQWIYVNLGSSQTVNRVKLNWEAAYASSYTIQVSNDSGTPTNWTTVYTTTTGDGG ---100-------110-------120-------130 IDDITFTARTAKYVRVHGTVRGTPYGYSLWEFEVYG |||||||||||||||||||||||||||||||||||| IDDITFTARTAKYVRVHGTVRGTPYGYSLWEFEVYG