Solution structure of chitosan-binding module 2 derived from chitosanase/glucanase from Paenibacillus sp. IK-5
NLALNKATAT SSIETAGHEG DKAVDGNAAT RWASAYGASP QWIYINLGST QSISRVKLNW EDAYATAYSI QVSNDSGSTP TNWTTVYSTT TGDGAIDDIT FAATNAKFVR VYATTRATAY GYSLWEFEVY G
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 81.4 % (1151 of 1414) | 77.1 % (546 of 708) | 83.6 % (469 of 561) | 93.8 % (136 of 145) |
Backbone | 98.2 % (768 of 782) | 97.4 % (263 of 270) | 99.0 % (379 of 383) | 97.7 % (126 of 129) |
Sidechain | 66.8 % (503 of 753) | 64.6 % (283 of 438) | 70.2 % (210 of 299) | 62.5 % (10 of 16) |
Aromatic | 39.2 % (65 of 166) | 42.2 % (35 of 83) | 33.3 % (26 of 78) | 80.0 % (4 of 5) |
Methyl | 88.2 % (134 of 152) | 88.2 % (67 of 76) | 88.2 % (67 of 76) |
1. DD2
NLALNKATAT SSIETAGHEG DKAVDGNAAT RWASAYGASP QWIYINLGST QSISRVKLNW EDAYATAYSI QVSNDSGSTP TNWTTVYSTT TGDGAIDDIT FAATNAKFVR VYATTRATAY GYSLWEFEVY GSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DD2 | [U-95% 13C; U-95% 15N] | protein | 0.4 mM |
2 | TRIS | natural abundance | buffer | 10 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | DD2 | [U-95% 13C; U-95% 15N] | protein | 0.4 mM |
6 | D2O | [U-2H] | solvent | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DD2 | [U-95% 13C; U-95% 15N] | protein | 0.4 mM |
2 | TRIS | natural abundance | buffer | 10 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DD2 | [U-95% 13C; U-95% 15N] | protein | 0.4 mM |
2 | TRIS | natural abundance | buffer | 10 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DD2 | [U-95% 13C; U-95% 15N] | protein | 0.4 mM |
2 | TRIS | natural abundance | buffer | 10 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DD2 | [U-95% 13C; U-95% 15N] | protein | 0.4 mM |
2 | TRIS | natural abundance | buffer | 10 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DD2 | [U-95% 13C; U-95% 15N] | protein | 0.4 mM |
2 | TRIS | natural abundance | buffer | 10 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DD2 | [U-95% 13C; U-95% 15N] | protein | 0.4 mM |
2 | TRIS | natural abundance | buffer | 10 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DD2 | [U-95% 13C; U-95% 15N] | protein | 0.4 mM |
2 | TRIS | natural abundance | buffer | 10 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | DD2 | [U-95% 13C; U-95% 15N] | protein | 0.4 mM |
6 | D2O | [U-2H] | solvent | 100 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | DD2 | [U-95% 13C; U-95% 15N] | protein | 0.4 mM |
6 | D2O | [U-2H] | solvent | 100 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 300 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | DD2 | [U-95% 13C; U-95% 15N] | protein | 0.4 mM |
6 | D2O | [U-2H] | solvent | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_11592_2rva.nef |
Input source #2: Coordindates | 2rva.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------------10--------20--------30--------40--------50--------60--------70--------80--------90---- HHHHHHNLALNKATATSSIETAGHEGDKAVDGNAATRWASAYGASPQWIYINLGSTQSISRVKLNWEDAYATAYSIQVSNDSGSTPTNWTTVYSTTTGDG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| HHHHHHNLALNKATATSSIETAGHEGDKAVDGNAATRWASAYGASPQWIYINLGSTQSISRVKLNWEDAYATAYSIQVSNDSGSTPTNWTTVYSTTTGDG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ---100-------110-------120-------130- AIDDITFAATNAKFVRVYATTRATAYGYSLWEFEVYG ||||||||||||||||||||||||||||||||||||| AIDDITFAATNAKFVRVYATTRATAYGYSLWEFEVYG -------110-------120-------130-------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 137 | 0 | 0 | 100.0 |
Content subtype: combined_11592_2rva.nef
Assigned chemical shifts
--------------10--------20--------30--------40--------50--------60--------70--------80--------90---- HHHHHHNLALNKATATSSIETAGHEGDKAVDGNAATRWASAYGASPQWIYINLGSTQSISRVKLNWEDAYATAYSIQVSNDSGSTPTNWTTVYSTTTGDG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......NLALNKATATSSIETAGHEGDKAVDGNAATRWASAYGASPQWIYINLGSTQSISRVKLNWEDAYATAYSIQVSNDSGSTPTNWTTVYSTTTGDG ---100-------110-------120-------130- AIDDITFAATNAKFVRVYATTRATAYGYSLWEFEVYG ||||||||||||||||||||||||||||||||||||| AIDDITFAATNAKFVRVYATTRATAYGYSLWEFEVYG
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 744 | 539 | 72.4 |
13C chemical shifts | 591 | 469 | 79.4 |
15N chemical shifts | 155 | 137 | 88.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 282 | 264 | 93.6 |
13C chemical shifts | 274 | 261 | 95.3 |
15N chemical shifts | 135 | 126 | 93.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 462 | 275 | 59.5 |
13C chemical shifts | 317 | 208 | 65.6 |
15N chemical shifts | 20 | 11 | 55.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 76 | 66 | 86.8 |
13C chemical shifts | 76 | 68 | 89.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 95 | 34 | 35.8 |
13C chemical shifts | 90 | 26 | 28.9 |
15N chemical shifts | 5 | 4 | 80.0 |
Distance restraints
--------------10--------20--------30--------40--------50--------60--------70--------80--------90---- HHHHHHNLALNKATATSSIETAGHEGDKAVDGNAATRWASAYGASPQWIYINLGSTQSISRVKLNWEDAYATAYSIQVSNDSGSTPTNWTTVYSTTTGDG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||| ......NLALNKATATSSIETAGHEGDKAVDGNAATRWASAYGASPQWIYINLGSTQSISRVKLNWEDAYATAYSIQVSNDS..TPTNWTTVYSTTTGDG ---100-------110-------120-------130- AIDDITFAATNAKFVRVYATTRATAYGYSLWEFEVYG ||||||||||||||||||||||||||||||||||||| AIDDITFAATNAKFVRVYATTRATAYGYSLWEFEVYG
--------------10--------20--------30--------40--------50--------60--------70--------80--------90---- HHHHHHNLALNKATATSSIETAGHEGDKAVDGNAATRWASAYGASPQWIYINLGSTQSISRVKLNWEDAYATAYSIQVSNDSGSTPTNWTTVYSTTTGDG |||||| ||||| |||||||||||| ||||||||||||||||||||||||| | |||||| | ||||||||| |||||||||||| ||| ........ALNKAT..SSIET.GHEGDKAVDGNA.TRWASAYGASPQWIYINLGSTQSIS.V.LNWEDA.A..YSIQVSNDS.STPTNWTTVYST..GDG ---100-------110-------120-------130- AIDDITFAATNAKFVRVYATTRATAYGYSLWEFEVYG ||||| ||| ||| ||||| | |||||||||| || AIDDI.FAA..AKF.RVYAT.R..AYGYSLWEFE.YG
Dihedral angle restraints
--------------10--------20--------30--------40--------50--------60--------70--------80--------90---- HHHHHHNLALNKATATSSIETAGHEGDKAVDGNAATRWASAYGASPQWIYINLGSTQSISRVKLNWEDAYATAYSIQVSNDSGSTPTNWTTVYSTTTGDG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......NLALNKATATSSIETAGHEGDKAVDGNAATRWASAYGASPQWIYINLGSTQSISRVKLNWEDAYATAYSIQVSNDSGSTPTNWTTVYSTTTGDG ---100-------110-------120-------130- AIDDITFAATNAKFVRVYATTRATAYGYSLWEFEVYG ||||||||||||||||||||||||||||||||||||| AIDDITFAATNAKFVRVYATTRATAYGYSLWEFEVYG