Solution structure of Zalpha domain of goldfish ZBP-containing protein kinase
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 77.9 % (608 of 780) | 86.9 % (358 of 412) | 61.0 % (180 of 295) | 95.9 % (70 of 73) |
Backbone | 81.1 % (308 of 380) | 95.3 % (122 of 128) | 66.8 % (127 of 190) | 95.2 % (59 of 62) |
Sidechain | 77.7 % (359 of 462) | 83.1 % (236 of 284) | 67.1 % (112 of 167) | 100.0 % (11 of 11) |
Aromatic | 31.8 % (14 of 44) | 59.1 % (13 of 22) | 0.0 % (0 of 21) | 100.0 % (1 of 1) |
Methyl | 83.8 % (57 of 68) | 94.1 % (32 of 34) | 73.5 % (25 of 34) |
1. entity
MSAETQMERK IIDFLRQNGK SIALTIAKEI GLDKSTVNRH LYNLQRSNQV FNSNEKPPVW DLMESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | caZapkz | [U-99% 13C; U-99% 15N] | protein | 1.0 mM |
2 | sodium chloride | natural abundance | salt | 100 mM |
3 | sodium phosphate | natural abundance | buffer | 10 mM |
4 | H2O | natural abundance | solvent | 90 % |
5 | D2O | [U-2H] | solvent | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | direct | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | direct | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | direct | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | direct | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | direct | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | direct | 0.1013291 |
Agilent DD2 - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | caZapkz | [U-99% 13C; U-99% 15N] | protein | 1.0 mM |
2 | sodium chloride | natural abundance | salt | 100 mM |
3 | sodium phosphate | natural abundance | buffer | 10 mM |
4 | H2O | natural abundance | solvent | 90 % |
5 | D2O | [U-2H] | solvent | 10 % |
Agilent DD2 - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | caZapkz | [U-99% 13C; U-99% 15N] | protein | 1.0 mM |
2 | sodium chloride | natural abundance | salt | 100 mM |
3 | sodium phosphate | natural abundance | buffer | 10 mM |
4 | H2O | natural abundance | solvent | 90 % |
5 | D2O | [U-2H] | solvent | 10 % |
Agilent DD2 - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | caZapkz | [U-99% 13C; U-99% 15N] | protein | 1.0 mM |
2 | sodium chloride | natural abundance | salt | 100 mM |
3 | sodium phosphate | natural abundance | buffer | 10 mM |
4 | H2O | natural abundance | solvent | 90 % |
5 | D2O | [U-2H] | solvent | 10 % |
Agilent DD2 - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | caZapkz | [U-99% 13C; U-99% 15N] | protein | 1.0 mM |
2 | sodium chloride | natural abundance | salt | 100 mM |
3 | sodium phosphate | natural abundance | buffer | 10 mM |
4 | H2O | natural abundance | solvent | 90 % |
5 | D2O | [U-2H] | solvent | 10 % |
Agilent DD2 - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | caZapkz | [U-99% 13C; U-99% 15N] | protein | 1.0 mM |
2 | sodium chloride | natural abundance | salt | 100 mM |
3 | sodium phosphate | natural abundance | buffer | 10 mM |
4 | H2O | natural abundance | solvent | 90 % |
5 | D2O | [U-2H] | solvent | 10 % |
Agilent DD2 - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | caZapkz | [U-99% 13C; U-99% 15N] | protein | 1.0 mM |
2 | sodium chloride | natural abundance | salt | 100 mM |
3 | sodium phosphate | natural abundance | buffer | 10 mM |
4 | H2O | natural abundance | solvent | 90 % |
5 | D2O | [U-2H] | solvent | 10 % |
Agilent DD2 - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | caZapkz | [U-99% 13C; U-99% 15N] | protein | 1.0 mM |
2 | sodium chloride | natural abundance | salt | 100 mM |
3 | sodium phosphate | natural abundance | buffer | 10 mM |
4 | H2O | natural abundance | solvent | 90 % |
5 | D2O | [U-2H] | solvent | 10 % |
Agilent DD2 - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | caZapkz | [U-99% 13C; U-99% 15N] | protein | 1.0 mM |
2 | sodium chloride | natural abundance | salt | 100 mM |
3 | sodium phosphate | natural abundance | buffer | 10 mM |
4 | H2O | natural abundance | solvent | 90 % |
5 | D2O | [U-2H] | solvent | 10 % |
Agilent DD2 - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | caZapkz | [U-99% 13C; U-99% 15N] | protein | 1.0 mM |
2 | sodium chloride | natural abundance | salt | 100 mM |
3 | sodium phosphate | natural abundance | buffer | 10 mM |
4 | H2O | natural abundance | solvent | 90 % |
5 | D2O | [U-2H] | solvent | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_11595_2rvc.nef |
Input source #2: Coordindates | 2rvc.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60---- MSAETQMERKIIDFLRQNGKSIALTIAKEIGLDKSTVNRHLYNLQRSNQVFNSNEKPPVWDLME |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSAETQMERKIIDFLRQNGKSIALTIAKEIGLDKSTVNRHLYNLQRSNQVFNSNEKPPVWDLME
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 64 | 0 | 0 | 100.0 |
Content subtype: combined_11595_2rvc.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60---- MSAETQMERKIIDFLRQNGKSIALTIAKEIGLDKSTVNRHLYNLQRSNQVFNSNEKPPVWDLME |||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||| ..AETQMERKIIDFLRQNGKSIALTIAKEIGLDKSTVNRHLYNLQRSNQVFNSNEK.PVWDLME
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
25 | THR | HG1 | 5.236 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 412 | 347 | 84.2 |
13C chemical shifts | 295 | 169 | 57.3 |
15N chemical shifts | 77 | 70 | 90.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 128 | 121 | 94.5 |
13C chemical shifts | 128 | 61 | 47.7 |
15N chemical shifts | 62 | 59 | 95.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 284 | 226 | 79.6 |
13C chemical shifts | 167 | 108 | 64.7 |
15N chemical shifts | 15 | 11 | 73.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 37 | 32 | 86.5 |
13C chemical shifts | 37 | 24 | 64.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 22 | 13 | 59.1 |
13C chemical shifts | 21 | 0 | 0.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60---- MSAETQMERKIIDFLRQNGKSIALTIAKEIGLDKSTVNRHLYNLQRSNQVFNSNEKPPVWDLME |||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||| ..AETQMERKIIDFLRQNGKSIALTIAKEIGLDKSTVNRHLYNLQRSNQVFNSNEK..VWDLME
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60---- MSAETQMERKIIDFLRQNGKSIALTIAKEIGLDKSTVNRHLYNLQRSNQVFNSNEKPPVWDLME ||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||| ..AETQMERKIIDFLRQNGKSIALTIAKEIGLDKSTVNRHLYNLQRSNQVFNSNE..PVWDLM --------10--------20--------30--------40--------50--------60---