Solution NMR structure of Monosiga brevicollis CRK/CRKL homolog (crka1) SH2 domain
GSSGSSGMAE AAAPWYHGPL SRTDAENSLL RMPEGTFLVR DSTSSPGDYV LSCSENGKVT HYKLSAEEGK IRIDTHLFDN LDAAITFYME HELEYSSLKQ PLQR
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 97.0 % (1124 of 1159) | 97.0 % (581 of 599) | 97.1 % (442 of 455) | 96.2 % (101 of 105) |
Backbone | 96.1 % (590 of 614) | 94.8 % (200 of 211) | 97.0 % (295 of 304) | 96.0 % (95 of 99) |
Sidechain | 98.0 % (628 of 641) | 98.2 % (381 of 388) | 97.6 % (241 of 247) | 100.0 % (6 of 6) |
Aromatic | 95.9 % (94 of 98) | 100.0 % (49 of 49) | 91.7 % (44 of 48) | 100.0 % (1 of 1) |
Methyl | 100.0 % (96 of 96) | 100.0 % (48 of 48) | 100.0 % (48 of 48) |
1. crka1 SH2 domain
GSSGSSGMAE AAAPWYHGPL SRTDAENSLL RMPEGTFLVR DSTSSPGDYV LSCSENGKVT HYKLSAEEGK IRIDTHLFDN LDAAITFYME HELEYSSLKQ PLQRSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | crka1 SH2 domain | [U-13C; U-15N] | protein | 1.1 mM |
2 | TRIS | [U-2H] | buffer | 20 mM |
3 | sodium chloride | natural abundance | salt | 100 mM |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DTT | [U-2H] | 1 mM | |
6 | D2O | [U-2H] | solvent | 10 % |
7 | H2O | natural abundance | solvent | 90 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.768 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.768 ppm | internal | direct | 1.0 |
15N | water | protons | 4.768 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.768 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.768 ppm | internal | direct | 1.0 |
15N | water | protons | 4.768 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.768 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.768 ppm | internal | direct | 1.0 |
15N | water | protons | 4.768 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.768 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.768 ppm | internal | direct | 1.0 |
15N | water | protons | 4.768 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | crka1 SH2 domain | [U-13C; U-15N] | protein | 1.1 mM |
2 | TRIS | [U-2H] | buffer | 20 mM |
3 | sodium chloride | natural abundance | salt | 100 mM |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DTT | [U-2H] | 1 mM | |
6 | D2O | [U-2H] | solvent | 10 % |
7 | H2O | natural abundance | solvent | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | crka1 SH2 domain | [U-13C; U-15N] | protein | 1.1 mM |
2 | TRIS | [U-2H] | buffer | 20 mM |
3 | sodium chloride | natural abundance | salt | 100 mM |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DTT | [U-2H] | 1 mM | |
6 | D2O | [U-2H] | solvent | 10 % |
7 | H2O | natural abundance | solvent | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | crka1 SH2 domain | [U-13C; U-15N] | protein | 1.1 mM |
2 | TRIS | [U-2H] | buffer | 20 mM |
3 | sodium chloride | natural abundance | salt | 100 mM |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DTT | [U-2H] | 1 mM | |
6 | D2O | [U-2H] | solvent | 10 % |
7 | H2O | natural abundance | solvent | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | crka1 SH2 domain | [U-13C; U-15N] | protein | 1.1 mM |
2 | TRIS | [U-2H] | buffer | 20 mM |
3 | sodium chloride | natural abundance | salt | 100 mM |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DTT | [U-2H] | 1 mM | |
6 | D2O | [U-2H] | solvent | 10 % |
7 | H2O | natural abundance | solvent | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | crka1 SH2 domain | [U-13C; U-15N] | protein | 1.1 mM |
2 | TRIS | [U-2H] | buffer | 20 mM |
3 | sodium chloride | natural abundance | salt | 100 mM |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DTT | [U-2H] | 1 mM | |
6 | D2O | [U-2H] | solvent | 10 % |
7 | H2O | natural abundance | solvent | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | crka1 SH2 domain | [U-13C; U-15N] | protein | 1.1 mM |
2 | TRIS | [U-2H] | buffer | 20 mM |
3 | sodium chloride | natural abundance | salt | 100 mM |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DTT | [U-2H] | 1 mM | |
6 | D2O | [U-2H] | solvent | 10 % |
7 | H2O | natural abundance | solvent | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | crka1 SH2 domain | [U-13C; U-15N] | protein | 1.1 mM |
2 | TRIS | [U-2H] | buffer | 20 mM |
3 | sodium chloride | natural abundance | salt | 100 mM |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DTT | [U-2H] | 1 mM | |
6 | D2O | [U-2H] | solvent | 10 % |
7 | H2O | natural abundance | solvent | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | crka1 SH2 domain | [U-13C; U-15N] | protein | 1.1 mM |
2 | TRIS | [U-2H] | buffer | 20 mM |
3 | sodium chloride | natural abundance | salt | 100 mM |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DTT | [U-2H] | 1 mM | |
6 | D2O | [U-2H] | solvent | 10 % |
7 | H2O | natural abundance | solvent | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | crka1 SH2 domain | [U-13C; U-15N] | protein | 1.1 mM |
2 | TRIS | [U-2H] | buffer | 20 mM |
3 | sodium chloride | natural abundance | salt | 100 mM |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DTT | [U-2H] | 1 mM | |
6 | D2O | [U-2H] | solvent | 10 % |
7 | H2O | natural abundance | solvent | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | crka1 SH2 domain | [U-13C; U-15N] | protein | 1.1 mM |
2 | TRIS | [U-2H] | buffer | 20 mM |
3 | sodium chloride | natural abundance | salt | 100 mM |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DTT | [U-2H] | 1 mM | |
6 | D2O | [U-2H] | solvent | 10 % |
7 | H2O | natural abundance | solvent | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | crka1 SH2 domain | [U-13C; U-15N] | protein | 1.1 mM |
2 | TRIS | [U-2H] | buffer | 20 mM |
3 | sodium chloride | natural abundance | salt | 100 mM |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DTT | [U-2H] | 1 mM | |
6 | D2O | [U-2H] | solvent | 10 % |
7 | H2O | natural abundance | solvent | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | crka1 SH2 domain | [U-13C; U-15N] | protein | 1.1 mM |
2 | TRIS | [U-2H] | buffer | 20 mM |
3 | sodium chloride | natural abundance | salt | 100 mM |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DTT | [U-2H] | 1 mM | |
6 | D2O | [U-2H] | solvent | 10 % |
7 | H2O | natural abundance | solvent | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | crka1 SH2 domain | [U-13C; U-15N] | protein | 1.1 mM |
2 | TRIS | [U-2H] | buffer | 20 mM |
3 | sodium chloride | natural abundance | salt | 100 mM |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DTT | [U-2H] | 1 mM | |
6 | D2O | [U-2H] | solvent | 10 % |
7 | H2O | natural abundance | solvent | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | crka1 SH2 domain | [U-13C; U-15N] | protein | 1.1 mM |
2 | TRIS | [U-2H] | buffer | 20 mM |
3 | sodium chloride | natural abundance | salt | 100 mM |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DTT | [U-2H] | 1 mM | |
6 | D2O | [U-2H] | solvent | 10 % |
7 | H2O | natural abundance | solvent | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | crka1 SH2 domain | [U-13C; U-15N] | protein | 1.1 mM |
2 | TRIS | [U-2H] | buffer | 20 mM |
3 | sodium chloride | natural abundance | salt | 100 mM |
4 | sodium azide | natural abundance | 0.02 % | |
5 | DTT | [U-2H] | 1 mM | |
6 | D2O | [U-2H] | solvent | 10 % |
7 | H2O | natural abundance | solvent | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_11597_2rvf.nef |
Input source #2: Coordindates | 2rvf.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---------------10--------20--------30--------40--------50--------60--------70--------80--------90--- GSSGSSGMAEAAAPWYHGPLSRTDAENSLLRMPEGTFLVRDSTSSPGDYVLSCSENGKVTHYKLSAEEGKIRIDTHLFDNLDAAITFYMEHELEYSSLKQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSSGSSGMAEAAAPWYHGPLSRTDAENSLLRMPEGTFLVRDSTSSPGDYVLSCSENGKVTHYKLSAEEGKIRIDTHLFDNLDAAITFYMEHELEYSSLKQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ---- PLQR |||| PLQR ----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 104 | 0 | 0 | 100.0 |
Content subtype: combined_11597_2rvf.nef
Assigned chemical shifts
---------------10--------20--------30--------40--------50--------60--------70--------80--------90--- GSSGSSGMAEAAAPWYHGPLSRTDAENSLLRMPEGTFLVRDSTSSPGDYVLSCSENGKVTHYKLSAEEGKIRIDTHLFDNLDAAITFYMEHELEYSSLKQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...GSSGMAEAAAPWYHGPLSRTDAENSLLRMPEGTFLVRDSTSSPGDYVLSCSENGKVTHYKLSAEEGKIRIDTHLFDNLDAAITFYMEHELEYSSLKQ ---- PLQR |||| PLQR
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
29 | THR | HG1 | 6.551 |
45 | SER | HG | 7.733 |
47 | SER | HG | 4.494 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 599 | 580 | 96.8 |
13C chemical shifts | 455 | 440 | 96.7 |
15N chemical shifts | 110 | 101 | 91.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 211 | 201 | 95.3 |
13C chemical shifts | 208 | 201 | 96.6 |
15N chemical shifts | 99 | 93 | 93.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 388 | 379 | 97.7 |
13C chemical shifts | 247 | 239 | 96.8 |
15N chemical shifts | 11 | 8 | 72.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 51 | 51 | 100.0 |
13C chemical shifts | 51 | 51 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 49 | 47 | 95.9 |
13C chemical shifts | 48 | 42 | 87.5 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
---------------10--------20--------30--------40--------50--------60--------70--------80--------90--- GSSGSSGMAEAAAPWYHGPLSRTDAENSLLRMPEGTFLVRDSTSSPGDYVLSCSENGKVTHYKLSAEEGKIRIDTHLFDNLDAAITFYMEHELEYSSLKQ |||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||| .......MAEAAAPWYHGPLSRTDAENSLLRMPEGTFLVRDST.SPGDYVLSCSENGKVTHYKLSAEEGKIRIDTHLFDNLDAAITFYMEHELEYSSLKQ ---- PLQR |||| PLQR
Dihedral angle restraints
---------------10--------20--------30--------40--------50--------60--------70--------80--------90--- GSSGSSGMAEAAAPWYHGPLSRTDAENSLLRMPEGTFLVRDSTSSPGDYVLSCSENGKVTHYKLSAEEGKIRIDTHLFDNLDAAITFYMEHELEYSSLKQ ||||||||||||||||||||||| |||||||||||||||||||||||||||| ||||||||||| ..................PLSRTDAENSLLRMPEGTFLVRD.....GDYVLSCSENGKVTHYKLSAEEGKIRID.....NLDAAITFYME.......... ---- PLQR |||| PLQR