Chimer between Spc-SH3 and P41
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.0 % (817 of 888) | 97.8 % (455 of 465) | 82.4 % (285 of 346) | 100.0 % (77 of 77) |
Backbone | 96.0 % (428 of 446) | 98.7 % (151 of 153) | 92.9 % (208 of 224) | 100.0 % (69 of 69) |
Sidechain | 89.5 % (458 of 512) | 97.4 % (304 of 312) | 76.0 % (146 of 192) | 100.0 % (8 of 8) |
Aromatic | 51.5 % (34 of 66) | 97.0 % (32 of 33) | 0.0 % (0 of 31) | 100.0 % (2 of 2) |
Methyl | 91.9 % (68 of 74) | 97.3 % (36 of 37) | 86.5 % (32 of 37) |
1. SPCp41
GAMGPREVTM KKGDILTLLN STNKDWWKVE VNDRQGFVPA AYVKKLDSGT GKELVLALYD YQESGDNAPS YSPPPPPSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 3.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SPCp41 | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | glycine | 20 mM | ||
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 3.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | SPCp41 | [U-98% 15N] | 1 mM | |
6 | glycine | 20 mM | ||
7 | H2O | 90 % | ||
8 | D2O | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 3.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | SPCp41 | 1 mM | ||
10 | glycine | 20 mM | ||
11 | H2O | 90 % | ||
12 | D2O | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 3.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SPCp41 | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | glycine | 20 mM | ||
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 3.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SPCp41 | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | glycine | 20 mM | ||
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 3.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SPCp41 | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | glycine | 20 mM | ||
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 3.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SPCp41 | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | glycine | 20 mM | ||
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 3.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SPCp41 | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | glycine | 20 mM | ||
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 3.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | SPCp41 | [U-98% 15N] | 1 mM | |
6 | glycine | 20 mM | ||
7 | H2O | 90 % | ||
8 | D2O | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 3.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | SPCp41 | [U-98% 15N] | 1 mM | |
6 | glycine | 20 mM | ||
7 | H2O | 90 % | ||
8 | D2O | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 3.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | SPCp41 | 1 mM | ||
10 | glycine | 20 mM | ||
11 | H2O | 90 % | ||
12 | D2O | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 3.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | SPCp41 | [U-98% 15N] | 1 mM | |
6 | glycine | 20 mM | ||
7 | H2O | 90 % | ||
8 | D2O | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 3.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | SPCp41 | [U-98% 15N] | 1 mM | |
6 | glycine | 20 mM | ||
7 | H2O | 90 % | ||
8 | D2O | 10 % |
Varian Varian NMR System - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 3.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SPCp41 | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | glycine | 20 mM | ||
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15013_2jmc.nef |
Input source #2: Coordindates | 2jmc.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70------- GAMGPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDSGTGKELVLALYDYQESGDNAPSYSPPPPP ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAMGPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDSGTGKELVLALYDYQESGDNAPSYSPPPPP
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 77 | 0 | 0 | 100.0 |
Content subtype: combined_15013_2jmc.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70------- GAMGPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDSGTGKELVLALYDYQESGDNAPSYSPPPPP ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAMGPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDSGTGKELVLALYDYQESGDNAPSYSPPPPP
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 465 | 453 | 97.4 |
15N chemical shifts | 79 | 78 | 98.7 |
13C chemical shifts | 346 | 282 | 81.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 153 | 152 | 99.3 |
15N chemical shifts | 69 | 68 | 98.6 |
13C chemical shifts | 154 | 139 | 90.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 312 | 301 | 96.5 |
15N chemical shifts | 10 | 10 | 100.0 |
13C chemical shifts | 192 | 143 | 74.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 39 | 37 | 94.9 |
13C chemical shifts | 39 | 31 | 79.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 33 | 32 | 97.0 |
15N chemical shifts | 2 | 2 | 100.0 |
13C chemical shifts | 31 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70------- GAMGPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDSGTGKELVLALYDYQESGDNAPSYSPPPPP ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAMGPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDSGTGKELVLALYDYQESGDNAPSYSPPPPP
--------10--------20--------30--------40--------50--------60--------70------- GAMGPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDSGTGKELVLALYDYQESGDNAPSYSPPPPP || |||||||||||||||||||||||||||||||||| |||| ||||||||||||||||| ||||||||||||| ..MG.REVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVP..YVKK.DSGTGKELVLALYDYQE.GDNAPSYSPPPPP
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70------- GAMGPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDSGTGKELVLALYDYQESGDNAPSYSPPPPP ||| ||||||||||||||||| |||||||||||||||||||||||||||||||||||| ||||||||||||| GAM.PREVTMKKGDILTLLNS.NKDWWKVEVNDRQGFVPAAYVKKLDSGTGKELVLAL.DYQESGDNAPSYS --------10--------20--------30--------40--------50--------60--------70--