Structure for the N-terminus of chromosomal replication initiation protein dnaA from M. genitalium
MEQFNAFKSL LKKHYEKTIG FHDKYIKDIN RFVFKNNVLL ILLENEFARN SLNDNSEIIH LAESLYEGIK SVNFVNEQDF FFNLAKLEEN SRDTLYQNSG
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 81.6 % (1025 of 1256) | 78.4 % (514 of 656) | 84.9 % (411 of 484) | 86.2 % (100 of 116) |
Backbone | 95.8 % (575 of 600) | 96.6 % (196 of 203) | 94.3 % (280 of 297) | 99.0 % (99 of 100) |
Sidechain | 72.4 % (545 of 753) | 70.2 % (318 of 453) | 79.6 % (226 of 284) | 6.3 % (1 of 16) |
Aromatic | 36.8 % (53 of 144) | 40.3 % (29 of 72) | 33.3 % (24 of 72) | |
Methyl | 95.2 % (99 of 104) | 94.2 % (49 of 52) | 96.2 % (50 of 52) |
1. N dnaA
MEQFNAFKSL LKKHYEKTIG FHDKYIKDIN RFVFKNNVLL ILLENEFARN SLNDNSEIIH LAESLYEGIK SVNFVNEQDF FFNLAKLEEN SRDTLYQNSGSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details uniformly 15N-labeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | N_dnaA | [U-100% 15N] | 0.75 (±0.2) mM | |
2 | sodium phosphate | 50 (±10.0) mM | ||
3 | sodium chloride | 100 (±10.0) mM | ||
4 | EDTA | 2 (±1.0) mM | ||
5 | sodium azide | 0.05 (±0.01) % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details uniformly 13C/15N-labeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | N_dnaA | [U-98% 13C; U-98% 15N] | 0.75 (±0.2) mM | |
7 | sodium phosphate | 50 (±10.0) mM | ||
8 | sodium chloride | 100 (±10.0) mM | ||
9 | EDTA | 2 (±1.0) mM | ||
10 | sodium azide | 0.05 (±0.01) % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details unlabeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | N_dnaA | natural abundance | 0.75 (±0.2) mM | |
12 | sodium phosphate | 50 (±10.0) mM | ||
13 | sodium chloride | 100 (±10.0) mM | ||
14 | EDTA | 2 (±1.0) mM | ||
15 | sodium azide | 0.05 (±0.01) % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details unlabeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | N_dnaA | [U-98% 13C; U-98% 15N] | 0.75 (±0.2) mM | |
17 | sodium phosphate | 50 (±10.0) mM | ||
18 | sodium chloride | 100 (±10.0) mM | ||
19 | EDTA | 2 (±1.0) mM | ||
20 | sodium azide | 0.05 (±0.01) % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details 10% 13C labeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | N_dnaA | [10% 13C] | 0.75 (±0.2) mM | |
22 | sodium phosphate | natural abundance | 50 (±10.0) mM | |
23 | sodium chloride | natural abundance | 100 (±10.0) mM | |
24 | EDTA | natural abundance | 2 (±1.0) mM | |
25 | sodium azide | natural abundance | 0.05 (±0.01) % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details uniformly 15N-labeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | N_dnaA | [U-100% 15N] | 0.75 (±0.2) mM | |
2 | sodium phosphate | 50 (±10.0) mM | ||
3 | sodium chloride | 100 (±10.0) mM | ||
4 | EDTA | 2 (±1.0) mM | ||
5 | sodium azide | 0.05 (±0.01) % |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details uniformly 13C/15N-labeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | N_dnaA | [U-98% 13C; U-98% 15N] | 0.75 (±0.2) mM | |
7 | sodium phosphate | 50 (±10.0) mM | ||
8 | sodium chloride | 100 (±10.0) mM | ||
9 | EDTA | 2 (±1.0) mM | ||
10 | sodium azide | 0.05 (±0.01) % |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details uniformly 13C/15N-labeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | N_dnaA | [U-98% 13C; U-98% 15N] | 0.75 (±0.2) mM | |
7 | sodium phosphate | 50 (±10.0) mM | ||
8 | sodium chloride | 100 (±10.0) mM | ||
9 | EDTA | 2 (±1.0) mM | ||
10 | sodium azide | 0.05 (±0.01) % |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details uniformly 13C/15N-labeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | N_dnaA | [U-98% 13C; U-98% 15N] | 0.75 (±0.2) mM | |
7 | sodium phosphate | 50 (±10.0) mM | ||
8 | sodium chloride | 100 (±10.0) mM | ||
9 | EDTA | 2 (±1.0) mM | ||
10 | sodium azide | 0.05 (±0.01) % |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details uniformly 13C/15N-labeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | N_dnaA | [U-98% 13C; U-98% 15N] | 0.75 (±0.2) mM | |
7 | sodium phosphate | 50 (±10.0) mM | ||
8 | sodium chloride | 100 (±10.0) mM | ||
9 | EDTA | 2 (±1.0) mM | ||
10 | sodium azide | 0.05 (±0.01) % |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details uniformly 13C/15N-labeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | N_dnaA | [U-98% 13C; U-98% 15N] | 0.75 (±0.2) mM | |
7 | sodium phosphate | 50 (±10.0) mM | ||
8 | sodium chloride | 100 (±10.0) mM | ||
9 | EDTA | 2 (±1.0) mM | ||
10 | sodium azide | 0.05 (±0.01) % |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details uniformly 13C/15N-labeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | N_dnaA | [U-98% 13C; U-98% 15N] | 0.75 (±0.2) mM | |
7 | sodium phosphate | 50 (±10.0) mM | ||
8 | sodium chloride | 100 (±10.0) mM | ||
9 | EDTA | 2 (±1.0) mM | ||
10 | sodium azide | 0.05 (±0.01) % |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details uniformly 15N-labeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | N_dnaA | [U-100% 15N] | 0.75 (±0.2) mM | |
2 | sodium phosphate | 50 (±10.0) mM | ||
3 | sodium chloride | 100 (±10.0) mM | ||
4 | EDTA | 2 (±1.0) mM | ||
5 | sodium azide | 0.05 (±0.01) % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details uniformly 13C/15N-labeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | N_dnaA | [U-98% 13C; U-98% 15N] | 0.75 (±0.2) mM | |
7 | sodium phosphate | 50 (±10.0) mM | ||
8 | sodium chloride | 100 (±10.0) mM | ||
9 | EDTA | 2 (±1.0) mM | ||
10 | sodium azide | 0.05 (±0.01) % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details uniformly 13C/15N-labeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | N_dnaA | [U-98% 13C; U-98% 15N] | 0.75 (±0.2) mM | |
7 | sodium phosphate | 50 (±10.0) mM | ||
8 | sodium chloride | 100 (±10.0) mM | ||
9 | EDTA | 2 (±1.0) mM | ||
10 | sodium azide | 0.05 (±0.01) % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details uniformly 15N-labeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | N_dnaA | [U-100% 15N] | 0.75 (±0.2) mM | |
2 | sodium phosphate | 50 (±10.0) mM | ||
3 | sodium chloride | 100 (±10.0) mM | ||
4 | EDTA | 2 (±1.0) mM | ||
5 | sodium azide | 0.05 (±0.01) % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details uniformly 13C/15N-labeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | N_dnaA | [U-98% 13C; U-98% 15N] | 0.75 (±0.2) mM | |
7 | sodium phosphate | 50 (±10.0) mM | ||
8 | sodium chloride | 100 (±10.0) mM | ||
9 | EDTA | 2 (±1.0) mM | ||
10 | sodium azide | 0.05 (±0.01) % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details uniformly 13C/15N-labeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | N_dnaA | [U-98% 13C; U-98% 15N] | 0.75 (±0.2) mM | |
7 | sodium phosphate | 50 (±10.0) mM | ||
8 | sodium chloride | 100 (±10.0) mM | ||
9 | EDTA | 2 (±1.0) mM | ||
10 | sodium azide | 0.05 (±0.01) % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details uniformly 13C/15N-labeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | N_dnaA | [U-98% 13C; U-98% 15N] | 0.75 (±0.2) mM | |
7 | sodium phosphate | 50 (±10.0) mM | ||
8 | sodium chloride | 100 (±10.0) mM | ||
9 | EDTA | 2 (±1.0) mM | ||
10 | sodium azide | 0.05 (±0.01) % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details uniformly 15N-labeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | N_dnaA | [U-100% 15N] | 0.75 (±0.2) mM | |
2 | sodium phosphate | 50 (±10.0) mM | ||
3 | sodium chloride | 100 (±10.0) mM | ||
4 | EDTA | 2 (±1.0) mM | ||
5 | sodium azide | 0.05 (±0.01) % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details uniformly 15N-labeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | N_dnaA | [U-100% 15N] | 0.75 (±0.2) mM | |
2 | sodium phosphate | 50 (±10.0) mM | ||
3 | sodium chloride | 100 (±10.0) mM | ||
4 | EDTA | 2 (±1.0) mM | ||
5 | sodium azide | 0.05 (±0.01) % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details unlabeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | N_dnaA | [U-98% 13C; U-98% 15N] | 0.75 (±0.2) mM | |
17 | sodium phosphate | 50 (±10.0) mM | ||
18 | sodium chloride | 100 (±10.0) mM | ||
19 | EDTA | 2 (±1.0) mM | ||
20 | sodium azide | 0.05 (±0.01) % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details unlabeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | N_dnaA | [U-98% 13C; U-98% 15N] | 0.75 (±0.2) mM | |
17 | sodium phosphate | 50 (±10.0) mM | ||
18 | sodium chloride | 100 (±10.0) mM | ||
19 | EDTA | 2 (±1.0) mM | ||
20 | sodium azide | 0.05 (±0.01) % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details unlabeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | N_dnaA | [U-98% 13C; U-98% 15N] | 0.75 (±0.2) mM | |
17 | sodium phosphate | 50 (±10.0) mM | ||
18 | sodium chloride | 100 (±10.0) mM | ||
19 | EDTA | 2 (±1.0) mM | ||
20 | sodium azide | 0.05 (±0.01) % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details 10% 13C labeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | N_dnaA | [10% 13C] | 0.75 (±0.2) mM | |
22 | sodium phosphate | natural abundance | 50 (±10.0) mM | |
23 | sodium chloride | natural abundance | 100 (±10.0) mM | |
24 | EDTA | natural abundance | 2 (±1.0) mM | |
25 | sodium azide | natural abundance | 0.05 (±0.01) % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details unlabeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | N_dnaA | natural abundance | 0.75 (±0.2) mM | |
12 | sodium phosphate | 50 (±10.0) mM | ||
13 | sodium chloride | 100 (±10.0) mM | ||
14 | EDTA | 2 (±1.0) mM | ||
15 | sodium azide | 0.05 (±0.01) % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details unlabeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | N_dnaA | natural abundance | 0.75 (±0.2) mM | |
12 | sodium phosphate | 50 (±10.0) mM | ||
13 | sodium chloride | 100 (±10.0) mM | ||
14 | EDTA | 2 (±1.0) mM | ||
15 | sodium azide | 0.05 (±0.01) % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±2) K, pH 6.8 (±0.2), Details unlabeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | N_dnaA | natural abundance | 0.75 (±0.2) mM | |
12 | sodium phosphate | 50 (±10.0) mM | ||
13 | sodium chloride | 100 (±10.0) mM | ||
14 | EDTA | 2 (±1.0) mM | ||
15 | sodium azide | 0.05 (±0.01) % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_15055_2jmp.nef |
Input source #2: Coordindates | 2jmp.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---------------10--------20--------30--------40--------50--------60--------70--------80--------90--- MGGGGGGMEQFNAFKSLLKKHYEKTIGFHDKYIKDINRFVFKNNVLLILLENEFARNSLNDNSEIIHLAESLYEGIKSVNFVNEQDFFFNLAKLEENSRD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGGGGGGMEQFNAFKSLLKKHYEKTIGFHDKYIKDINRFVFKNNVLLILLENEFARNSLNDNSEIIHLAESLYEGIKSVNFVNEQDFFFNLAKLEENSRD --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ----100 TLYQNSG ||||||| TLYQNSG -------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 107 | 0 | 0 | 100.0 |
Content subtype: combined_15055_2jmp.nef
Assigned chemical shifts
---------------10--------20--------30--------40--------50--------60--------70--------80--------90--- MGGGGGGMEQFNAFKSLLKKHYEKTIGFHDKYIKDINRFVFKNNVLLILLENEFARNSLNDNSEIIHLAESLYEGIKSVNFVNEQDFFFNLAKLEENSRD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ........EQFNAFKSLLKKHYEKTIGFHDKYIKDINRFVFKNNVLLILLENEFARNSLNDNSEIIHLAESLYEGIKSVNFVNEQDFFFNLAKLEENSRD ----100 TLYQNSG ||||||| TLYQNSG
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 681 | 500 | 73.4 |
13C chemical shifts | 501 | 403 | 80.4 |
15N chemical shifts | 126 | 99 | 78.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 223 | 200 | 89.7 |
13C chemical shifts | 214 | 182 | 85.0 |
15N chemical shifts | 107 | 99 | 92.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 458 | 300 | 65.5 |
13C chemical shifts | 287 | 221 | 77.0 |
15N chemical shifts | 19 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 51 | 94.4 |
13C chemical shifts | 54 | 51 | 94.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 72 | 20 | 27.8 |
13C chemical shifts | 72 | 18 | 25.0 |
Distance restraints
---------------10--------20--------30--------40--------50--------60--------70--------80--------90--- MGGGGGGMEQFNAFKSLLKKHYEKTIGFHDKYIKDINRFVFKNNVLLILLENEFARNSLNDNSEIIHLAESLYEGIKSVNFVNEQDFFFNLAKLEENSRD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ........EQFNAFKSLLKKHYEKTIGFHDKYIKDINRFVFKNNVLLILLENEFARNSLNDNSEIIHLAESLYEGIKSVNFVNEQDFFFNLAKLEENSRD ---------------10--------20--------30--------40--------50--------60--------70--------80--------90--- ----100 TLYQNSG |||| TLYQ ----
Dihedral angle restraints
---------------10--------20--------30--------40--------50--------60--------70--------80--------90--- MGGGGGGMEQFNAFKSLLKKHYEKTIGFHDKYIKDINRFVFKNNVLLILLENEFARNSLNDNSEIIHLAESLYEGIKSVNFVNEQDFFFNLAKLEENSRD || ||||| |||||| |||||| ||||||||||||| ||| |||||| || ||| ||| ||||| ||||| |||| || || .......ME.FNAFK..LKKHYE.TIGFHD.....INRFVFKNNVLLI.LEN.FARNSL.DN.EII.LAE.LYEGI.SVNFV.EQDF..NL.....NS.. ---------------10--------20--------30--------40--------50--------60--------70--------80--------90--- ----100 TLYQNSG |||| ..YQNS ------
RDC restraints