NMR structure of cl-BABP complexed to chenodeoxycholic acid
AFSGTWQVYA QENYEEFLKA LALPEDLIKM ARDIKPIVEI QQKGDDFVVT SKTPRQTVTN SFTLGKEADI TTMDGKKLKC TVHLANGKLV TKSEKFSHEQ EVKGNEMVET ITFGGVTLIR RSKRV
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.2 % (1428 of 1484) | 95.7 % (740 of 773) | 98.4 % (569 of 578) | 89.5 % (119 of 133) |
Backbone | 98.8 % (735 of 744) | 98.0 % (250 of 255) | 99.7 % (366 of 367) | 97.5 % (119 of 122) |
Sidechain | 94.5 % (810 of 857) | 94.6 % (490 of 518) | 97.6 % (320 of 328) | 0.0 % (0 of 11) |
Aromatic | 92.7 % (89 of 96) | 97.9 % (47 of 48) | 89.4 % (42 of 47) | 0.0 % (0 of 1) |
Methyl | 99.3 % (147 of 148) | 100.0 % (74 of 74) | 98.6 % (73 of 74) |
1. cl-BABP
AFSGTWQVYA QENYEEFLKA LALPEDLIKM ARDIKPIVEI QQKGDDFVVT SKTPRQTVTN SFTLGKEADI TTMDGKKLKC TVHLANGKLV TKSEKFSHEQ EVKGNEMVET ITFGGVTLIR RSKRVSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | cl-BABP | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | CDA | natural abundance | 3 mM | |
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | cl-BABP | [U-100% 13C; U-100% 15N] | 1.2 mM | |
6 | CDA | natural abundance | 3 mM | |
7 | H2O | 100 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | cl-BABP | [U-100% 13C; U-100% 15N] | 1.2 mM | |
9 | CDA | natural abundance | 3 mM | |
10 | H2O | 90 % | ||
11 | D2O | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | cl-BABP | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | CDA | natural abundance | 3 mM | |
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Bruker Avance - 400 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | cl-BABP | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | CDA | natural abundance | 3 mM | |
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Bruker Avance - 400 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | cl-BABP | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | CDA | natural abundance | 3 mM | |
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Bruker Avance - 400 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | cl-BABP | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | CDA | natural abundance | 3 mM | |
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Bruker Avance - 400 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | cl-BABP | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | CDA | natural abundance | 3 mM | |
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | cl-BABP | [U-100% 13C; U-100% 15N] | 1.2 mM | |
6 | CDA | natural abundance | 3 mM | |
7 | H2O | 100 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | cl-BABP | [U-100% 13C; U-100% 15N] | 1.2 mM | |
6 | CDA | natural abundance | 3 mM | |
7 | H2O | 100 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | cl-BABP | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | CDA | natural abundance | 3 mM | |
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | cl-BABP | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | CDA | natural abundance | 3 mM | |
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | cl-BABP | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | CDA | natural abundance | 3 mM | |
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | cl-BABP | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | CDA | natural abundance | 3 mM | |
3 | H2O | 90 % | ||
4 | D2O | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | cl-BABP | [U-100% 13C; U-100% 15N] | 1.2 mM | |
6 | CDA | natural abundance | 3 mM | |
7 | H2O | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_15084_2jn3.nef |
Input source #2: Coordindates | 2jn3.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Error |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | JN3 | CHENODEOXYCHOLIC ACID | Distance restraints |
B | 2 | JN3 | CHENODEOXYCHOLIC ACID | None |
Sequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 AFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQ -------110-------120----- EVKGNEMVETITFGGVTLIRRSKRV ||||||||||||||||||||||||| EVKGNEMVETITFGGVTLIRRSKRV
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 125 | 0 | 0 | 100.0 |
Content subtype: combined_15084_2jn3.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 AFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQ -------110-------120----- EVKGNEMVETITFGGVTLIRRSKRV ||||||||||||||||||||||||| EVKGNEMVETITFGGVTLIRRSKRV
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
7 | GLN | CD | 179.24 |
11 | GLN | CD | 177.2 |
12 | GLU | CD | 182.9 |
13 | ASN | CG | 178.59 |
15 | GLU | CD | 183.04 |
16 | GLU | CD | 183.54 |
25 | GLU | CD | 183.23 |
26 | ASP | CG | 179.28 |
33 | ASP | CG | 180.23 |
39 | GLU | CD | 183.16 |
41 | GLN | CD | 180.01 |
42 | GLN | CD | 179.1 |
45 | ASP | CG | 179.8 |
46 | ASP | CG | 180.2 |
56 | GLN | CD | 179.6 |
60 | ASN | CG | 176.5 |
67 | GLU | CD | 183.51 |
69 | ASP | CG | 180.6 |
74 | ASP | CG | 179.43 |
83 | HIS | ND1 | 218.1 |
83 | HIS | NE2 | 184.7 |
86 | ASN | CG | 178.0 |
94 | GLU | CD | 183.7 |
98 | HIS | ND1 | 253.0 |
98 | HIS | NE2 | 162.2 |
99 | GLU | CD | 183.46 |
100 | GLN | CD | 176.5 |
101 | GLU | CD | 182.51 |
105 | ASN | CG | 177.54 |
106 | GLU | CD | 183.216 |
109 | GLU | CD | 183.05 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 773 | 744 | 96.2 |
13C chemical shifts | 578 | 569 | 98.4 |
15N chemical shifts | 138 | 119 | 86.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 255 | 253 | 99.2 |
13C chemical shifts | 250 | 249 | 99.6 |
15N chemical shifts | 122 | 119 | 97.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 518 | 491 | 94.8 |
13C chemical shifts | 328 | 320 | 97.6 |
15N chemical shifts | 16 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 77 | 77 | 100.0 |
13C chemical shifts | 77 | 76 | 98.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 48 | 47 | 97.9 |
13C chemical shifts | 47 | 42 | 89.4 |
15N chemical shifts | 1 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 AFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQ -------110-------120----- EVKGNEMVETITFGGVTLIRRSKRV ||||||||||||||||||||||||| EVKGNEMVETITFGGVTLIRRSKRV
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 AFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQ | ||||| ||||||||||| ||||||||| | |||||| | |||||||| || | | || || | | | | | | || | |||| | ||||| ...G.WQVYA.ENYEEFLKALA.PEDLIKMAR.I.PIVEIQ.K..DFVVTSKT.RQ.V.N.FT.GK.A.I.T...K.L.C.VH.A..KLVT.S..FSHEQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120----- EVKGNEMVETITFGGVTLIRRSKRV | | ||||||||| | ||||||| E.K.NEMVETITF..V.LIRRSKR -------110-------120----
-- XX | X -
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 AFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .FSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQ -------110-------120----- EVKGNEMVETITFGGVTLIRRSKRV ||||||||||||||||||||||||| EVKGNEMVETITFGGVTLIRRSKRV
RDC restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 AFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQ |||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .FSGTWQVYAQENYEEFLKALALPEDLIKMARDIK.IVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQ -------110-------120----- EVKGNEMVETITFGGVTLIRRSKRV ||| ||||||||||||||| ||||| EVK.NEMVETITFGGVTLI.RSKRV