Northeast Structural Genomics Consortium Target ER411
MSNTTWGLQR DITPRLGARL VQEGNQLHYL ADRASITGKF SDAECPKLDV VFPHFISQIE SMLTTGELNP RHAQCVTLYH NGFTCEADTL GSCGYVYIAV YPTQRLEHHH HHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 71.5 % (924 of 1293) | 77.3 % (513 of 664) | 60.8 % (310 of 510) | 84.9 % (101 of 119) |
Backbone | 78.1 % (522 of 668) | 90.4 % (207 of 229) | 65.3 % (216 of 331) | 91.7 % (99 of 108) |
Sidechain | 67.1 % (490 of 730) | 69.2 % (301 of 435) | 65.8 % (187 of 284) | 18.2 % (2 of 11) |
Aromatic | 51.5 % (68 of 132) | 53.0 % (35 of 66) | 49.2 % (32 of 65) | 100.0 % (1 of 1) |
Methyl | 85.2 % (104 of 122) | 90.2 % (55 of 61) | 80.3 % (49 of 61) |
1. ER411
MSNTTWGLQR DITPRLGARL VQEGNQLHYL ADRASITGKF SDAECPKLDV VFPHFISQIE SMLTTGELNP RHAQCVTLYH NGFTCEADTL GSCGYVYIAV YPTQRLEHHH HHHSolvent system 90% H2O/10% D2O, Temperature 298 K, pH 6.5, Details 13C,15N ER411, 1.1 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ER411 | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | sodium azide | natural abundance | 0.02 % | |
3 | TRIS | natural abundance | 10 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | H2O | 90 % | ||
6 | D2O | 10 % |
Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 6.5, Details 13C,15N ER411,0.5 mM in phage (5mg/ml)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | ER411 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
8 | sodium azide | natural abundance | 0.02 % | |
9 | TRIS | natural abundance | 10 mM | |
10 | sodium chloride | natural abundance | 250 mM | |
11 | Pf1 phage | natural abundance | 5 mg | |
12 | H2O | 90 % | ||
13 | D2O | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Temperature 298 K, pH 6.5
Experiment name 2D 1H-15N HSQC
List #1 RDC_list_1, RDC code DCAHA, Field strength (1H) 600 MHz
List #1 RDC_list_1, RDC code DHNCO, Field strength (1H) 600 MHz
List #1 RDC_list_1, RDC code DNH, Field strength (1H) 600 MHz
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 6.5, Details 13C,15N ER411, 1.1 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ER411 | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | sodium azide | natural abundance | 0.02 % | |
3 | TRIS | natural abundance | 10 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | H2O | 90 % | ||
6 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 6.5, Details 13C,15N ER411, 1.1 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ER411 | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | sodium azide | natural abundance | 0.02 % | |
3 | TRIS | natural abundance | 10 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | H2O | 90 % | ||
6 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 6.5, Details 13C,15N ER411, 1.1 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ER411 | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | sodium azide | natural abundance | 0.02 % | |
3 | TRIS | natural abundance | 10 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | H2O | 90 % | ||
6 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 6.5, Details 13C,15N ER411, 1.1 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ER411 | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | sodium azide | natural abundance | 0.02 % | |
3 | TRIS | natural abundance | 10 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | H2O | 90 % | ||
6 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 6.5, Details 13C,15N ER411, 1.1 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ER411 | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | sodium azide | natural abundance | 0.02 % | |
3 | TRIS | natural abundance | 10 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | H2O | 90 % | ||
6 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 6.5, Details 13C,15N ER411, 1.1 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ER411 | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | sodium azide | natural abundance | 0.02 % | |
3 | TRIS | natural abundance | 10 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | H2O | 90 % | ||
6 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 6.5, Details 13C,15N ER411, 1.1 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ER411 | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | sodium azide | natural abundance | 0.02 % | |
3 | TRIS | natural abundance | 10 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | H2O | 90 % | ||
6 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 6.5, Details 13C,15N ER411, 1.1 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ER411 | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | sodium azide | natural abundance | 0.02 % | |
3 | TRIS | natural abundance | 10 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | H2O | 90 % | ||
6 | D2O | 10 % |
Varian INOVA - 600 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 6.5, Details 13C,15N ER411,0.5 mM in phage (5mg/ml)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | ER411 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
8 | sodium azide | natural abundance | 0.02 % | |
9 | TRIS | natural abundance | 10 mM | |
10 | sodium chloride | natural abundance | 250 mM | |
11 | Pf1 phage | natural abundance | 5 mg | |
12 | H2O | 90 % | ||
13 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 6.5, Details 13C,15N ER411, 1.1 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ER411 | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | sodium azide | natural abundance | 0.02 % | |
3 | TRIS | natural abundance | 10 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | H2O | 90 % | ||
6 | D2O | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_15088_2jn7.nef |
Input source #2: Coordindates | 2jn7.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSNTTWGLQRDITPRLGARLVQEGNQLHYLADRASITGKFSDAECPKLDVVFPHFISQIESMLTTGELNPRHAQCVTLYHNGFTCEADTLGSCGYVYIAV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSNTTWGLQRDITPRLGARLVQEGNQLHYLADRASITGKFSDAECPKLDVVFPHFISQIESMLTTGELNPRHAQCVTLYHNGFTCEADTLGSCGYVYIAV -------110--- YPTQRLEHHHHHH ||||||||||||| YPTQRLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 113 | 0 | 0 | 100.0 |
Content subtype: combined_15088_2jn7.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSNTTWGLQRDITPRLGARLVQEGNQLHYLADRASITGKFSDAECPKLDVVFPHFISQIESMLTTGELNPRHAQCVTLYHNGFTCEADTLGSCGYVYIAV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..NTTWGLQRDITPRLGARLVQEGNQLHYLADRASITGKFSDAECPKLDVVFPHFISQIESMLTTGELNPRHAQCVTLYHNGFTCEADTLGSCGYVYIAV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110--- YPTQRLEHHHHHH ||||| YPTQR -----
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 664 | 514 | 77.4 |
13C chemical shifts | 510 | 287 | 56.3 |
15N chemical shifts | 125 | 98 | 78.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 229 | 208 | 90.8 |
13C chemical shifts | 226 | 102 | 45.1 |
15N chemical shifts | 108 | 97 | 89.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 435 | 306 | 70.3 |
13C chemical shifts | 284 | 185 | 65.1 |
15N chemical shifts | 17 | 1 | 5.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 63 | 60 | 95.2 |
13C chemical shifts | 63 | 51 | 81.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 66 | 33 | 50.0 |
13C chemical shifts | 65 | 32 | 49.2 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSNTTWGLQRDITPRLGARLVQEGNQLHYLADRASITGKFSDAECPKLDVVFPHFISQIESMLTTGELNPRHAQCVTLYHNGFTCEADTLGSCGYVYIAV ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...TTWGLQRDITPRLGARLVQEGNQLHYLADRASITGKFSDAECPKLDVVFPHFISQIESMLTTGELNPRHAQCVTLYHNGFTCEADTLGSCGYVYIAV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110--- YPTQRLEHHHHHH ||||| YPTQR -----