BMRBj - BMREntryMaster

	Total	¹H	¹³C	¹⁵N
All	95.5 % (1022 of 1070)	95.5 % (549 of 575)	95.6 % (387 of 405)	95.6 % (86 of 90)
Backbone	95.5 % (504 of 528)	94.4 % (169 of 179)	96.2 % (255 of 265)	95.2 % (80 of 84)
Sidechain	95.9 % (601 of 627)	96.0 % (380 of 396)	95.6 % (215 of 225)	100.0 % (6 of 6)
Aromatic	100.0 % (30 of 30)	100.0 % (15 of 15)	100.0 % (15 of 15)
Methyl	100.0 % (74 of 74)	100.0 % (37 of 37)	100.0 % (37 of 37)

1. Brd4-ET domain

GSSGSSGESE EEDKCKPMSY EEKRQLSLDI NKLPGEKLGR VVHIIQSREP SLKNSNPDEI EIDFETLKPS TLRELERYVT SCLRKKRKPQ

Show sample condition

Sample

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0

#	Name	Isotope labeling	Concentration
1	Brd4-ET domain	[U-100% 13C; U-100% 15N]	1.05 mM
2	sodium chloride	natural abundance	100 mM
3	TRIS	[U-2H]	20 mM
4	DTT	[U-2H]	1 mM
5	sodium azide	natural abundance	0.02 %

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	null	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	null	indirect	0.1013291

Referencing offset: -0.06 ppm, Outliers: 1 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	null	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	null	indirect	0.1013291

Referencing offset: -0.06 ppm, Outliers: 1 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	null	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	null	indirect	0.1013291

Referencing offset: 0.12 ppm, Outliers: 3 Detail

LACS Plot; CO

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	null	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	null	indirect	0.1013291

Referencing offset: -0.29 ppm, Outliers: 1 Detail

Protein Blocks Logo

Calculated from 20 models in PDB: 2JNS, Strand ID: A Detail

Release date

2008-10-26

Citation

Solution structure of the extraterminal domain of the bromodomain-containing protein BRD4
Lin, Y., Umehara, T., Inoue, M., Saito, K., Kigawa, T., Jang, M., Ozato, K., Yokoyama, S., Padmanabhan, B., Guntert, P.
Protein Sci. (2008), 17, 2174-2179, PubMed 18815416 , DOI 10.1110/ps.037580.108 , Abstract

Related entities 1. monomer, : 1 : 9 : 67 entities Detail

Interaction partners 1. monomer, : 42 interactors Detail

More details for 42 interactors identified by 19 citations

Experiments performed 2 experiments Detail

NMR combined restraints 4 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_15125_2jns.nef
Input source #2: Coordindates	2jns.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--------10--------20--------30--------40--------50--------60--------70--------80--------90
GSSGSSGESEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQ
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
GSSGSSGESEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQ

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	90	0	0	100.0

Content subtype: combined_15125_2jns.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	1023		96.7 (chain: A, length: 90)
1	Distance restraints	DYANA/DIANA_distance_constraints_2	OK	2280 (1)	noe	92.2 (chain: A, length: 90)
1	Dihedral angle restraints	DYANA/DIANA_dihedral_3	OK	107 (107)	.	75.6 (chain: A, length: 90)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 90, Sequence coverage: 96.7%
- Total number of assignments
  - ¹³C chemical shifts: 387
  - ¹H chemical shifts: 549
  - ¹⁵N chemical shifts: 87
- Completeness of assignments
  - Entity_assemble_ID: A
- Redox state of CYS
- Peptide bond of PRO
- Tautomeric state of HIS
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	405	387	95.6
¹H chemical shifts	575	549	95.5
¹⁵N chemical shifts	97	87	89.7

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	180	172	95.6
¹H chemical shifts	179	169	94.4
¹⁵N chemical shifts	84	80	95.2

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	225	215	95.6
¹H chemical shifts	396	380	96.0
¹⁵N chemical shifts	13	7	53.8

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	38	38	100.0
¹H chemical shifts	38	38	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	15	15	100.0
¹H chemical shifts	15	15	100.0

Distance restraints

Saveframe: DYANA/DIANA_distance_constraints_2
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 90, Sequence coverage: 92.2%
- Total number of restraints: 2274
- Weight of restraints: 1.0 (2274)
- Potential type of restraints: upper-bound-parabolic (2274)
- Range of distance target values: 2.35, 5.5 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map

Dihedral angle restraints

Saveframe: DYANA/DIANA_dihedral_3
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 90, Sequence coverage: 75.6%
- Total number of restraints: 107
- Total number of restraints per polymer type: 107
- Weight of restraints: 1.0 (107)
- Potential type of restraints: square-well-parabolic (107)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

Keywords Bromodomain containing protein 4, ET-domain

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (1.691 seconds)

BMRB: 15125

Sample

Chemical shift reference

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. monomer, : 1 : 9 : 67 entities Detail

Interaction partners 1. monomer, : 42 interactors Detail

Experiments performed 2 experiments Detail

Instrument

Sample

Instrument

Sample

NMR combined restraints 4 contents Detail