Solution structure of phl p 3, a major allergen from timothy grass pollen
RGSHHHHHHG SAVQVTFTVQ KGSDPKKLVL DIKYTRPGDS LAEVELRQHG SEEWEPLTKK GNVWEVKSSK PLVGPFNFRF MSKGGMRNVF DEVIPTAFSI GKTYKPEE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 85.0 % (1092 of 1285) | 89.0 % (600 of 674) | 78.9 % (396 of 502) | 88.1 % (96 of 109) |
Backbone | 90.4 % (573 of 634) | 90.9 % (199 of 219) | 90.4 % (284 of 314) | 89.1 % (90 of 101) |
Sidechain | 81.6 % (611 of 749) | 88.1 % (401 of 455) | 71.3 % (204 of 286) | 75.0 % (6 of 8) |
Aromatic | 41.4 % (53 of 128) | 75.0 % (48 of 64) | 4.8 % (3 of 62) | 100.0 % (2 of 2) |
Methyl | 93.6 % (88 of 94) | 100.0 % (47 of 47) | 87.2 % (41 of 47) |
1. phl p 3
RGSHHHHHHG SAVQVTFTVQ KGSDPKKLVL DIKYTRPGDS LAEVELRQHG SEEWEPLTKK GNVWEVKSSK PLVGPFNFRF MSKGGMRNVF DEVIPTAFSI GKTYKPEESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phl p 3 | [U-95% 13C; U-95% 15N] | 2 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | phosphate buffer | natural abundance | 20 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details Pf1 phage solution for RDC measurements
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | phl p 3 | [U-95% 13C; U-95% 15N] | 1 mM | |
6 | Pf1 phage | natural abundance | 10 mg/mL | |
7 | DTT | natural abundance | 1 mM | |
8 | NaCl | natural abundance | 100 mM | |
9 | phosphate buffer | natural abundance | 20 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phl p 3 | [U-95% 13C; U-95% 15N] | 2 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | phosphate buffer | natural abundance | 20 mM |
Bruker Avance - 700 MHz equipped with CryoProbe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phl p 3 | [U-95% 13C; U-95% 15N] | 2 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | phosphate buffer | natural abundance | 20 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phl p 3 | [U-95% 13C; U-95% 15N] | 2 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | phosphate buffer | natural abundance | 20 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phl p 3 | [U-95% 13C; U-95% 15N] | 2 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | phosphate buffer | natural abundance | 20 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phl p 3 | [U-95% 13C; U-95% 15N] | 2 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | phosphate buffer | natural abundance | 20 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phl p 3 | [U-95% 13C; U-95% 15N] | 2 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | phosphate buffer | natural abundance | 20 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phl p 3 | [U-95% 13C; U-95% 15N] | 2 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | phosphate buffer | natural abundance | 20 mM |
Bruker Avance - 700 MHz equipped with CryoProbe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phl p 3 | [U-95% 13C; U-95% 15N] | 2 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | phosphate buffer | natural abundance | 20 mM |
Bruker Avance - 700 MHz equipped with CryoProbe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phl p 3 | [U-95% 13C; U-95% 15N] | 2 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | phosphate buffer | natural abundance | 20 mM |
Bruker Avance - 700 MHz equipped with CryoProbe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phl p 3 | [U-95% 13C; U-95% 15N] | 2 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | phosphate buffer | natural abundance | 20 mM |
Bruker Avance - 700 MHz equipped with CryoProbe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phl p 3 | [U-95% 13C; U-95% 15N] | 2 mM | |
2 | DTT | natural abundance | 1 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | phosphate buffer | natural abundance | 20 mM |
Bruker DRX - 600 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details Pf1 phage solution for RDC measurements
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | phl p 3 | [U-95% 13C; U-95% 15N] | 1 mM | |
6 | Pf1 phage | natural abundance | 10 mg/mL | |
7 | DTT | natural abundance | 1 mM | |
8 | NaCl | natural abundance | 100 mM | |
9 | phosphate buffer | natural abundance | 20 mM |
Bruker DRX - 600 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details Pf1 phage solution for RDC measurements
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | phl p 3 | [U-95% 13C; U-95% 15N] | 1 mM | |
6 | Pf1 phage | natural abundance | 10 mg/mL | |
7 | DTT | natural abundance | 1 mM | |
8 | NaCl | natural abundance | 100 mM | |
9 | phosphate buffer | natural abundance | 20 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_15134_2jnz.nef |
Input source #2: Coordindates | 2jnz.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 RGSHHHHHHGSAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKKGNVWEVKSSKPLVGPFNFRFMSKGGMRNVFDEVIPTAFSI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| RGSHHHHHHGSAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKKGNVWEVKSSKPLVGPFNFRFMSKGGMRNVFDEVIPTAFSI -------- GKTYKPEE |||||||| GKTYKPEE
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 108 | 0 | 0 | 100.0 |
Content subtype: combined_15134_2jnz.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 RGSHHHHHHGSAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKKGNVWEVKSSKPLVGPFNFRFMSKGGMRNVFDEVIPTAFSI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..........SAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKKGNVWEVKSSKPLVGPFNFRFMSKGGMRNVFDEVIPTAFSI -------- GKTYKPEE |||||||| GKTYKPEE
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 674 | 588 | 87.2 |
13C chemical shifts | 502 | 386 | 76.9 |
15N chemical shifts | 114 | 95 | 83.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 219 | 195 | 89.0 |
13C chemical shifts | 216 | 187 | 86.6 |
15N chemical shifts | 101 | 89 | 88.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 455 | 393 | 86.4 |
13C chemical shifts | 286 | 199 | 69.6 |
15N chemical shifts | 13 | 6 | 46.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 49 | 49 | 100.0 |
13C chemical shifts | 49 | 43 | 87.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 64 | 46 | 71.9 |
13C chemical shifts | 62 | 1 | 1.6 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 RGSHHHHHHGSAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKKGNVWEVKSSKPLVGPFNFRFMSKGGMRNVFDEVIPTAFSI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..........SAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKKGNVWEVKSSKPLVGPFNFRFMSKGGMRNVFDEVIPTAFSI -------- GKTYKPEE |||||||| GKTYKPEE
Dihedral angle restraints
RDC restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 RGSHHHHHHGSAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKKGNVWEVKSSKPLVGPFNFRFMSKGGMRNVFDEVIPTAFSI ||||||||| |||||||||||||| |||||||||||||| ||||||| ||||||| ||||||||||||||||||||||||||||| ............VQVTFTVQK.SDPKKLVLDIKYTR..DSLAEVELRQHGSE.WEPLTKK.NVWEVKS...LVGPFNFRFMSKGGMRNVFDEVIPTAFSI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------- GKTYKPEE |||| GKTY ----