Solution Structure of Protein HP0495 from H. pylori; Northeast structural genomics consortium target PT2; Ontario Centre for Structural Proteomics target HP0488
QGHMPSDSKK PTIIYPCLWD YRVIMTTKDT STLKELLETY QRPFKLEFKN TSKNAKFYSF NVSMEVSNES ERNEIFQKIS QLDKVVQTLG S
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.6 % (1074 of 1124) | 95.8 % (566 of 591) | 95.4 % (415 of 435) | 94.9 % (93 of 98) |
Backbone | 95.5 % (514 of 538) | 97.2 % (175 of 180) | 94.5 % (256 of 271) | 95.4 % (83 of 87) |
Sidechain | 95.7 % (646 of 675) | 95.1 % (391 of 411) | 96.8 % (245 of 253) | 90.9 % (10 of 11) |
Aromatic | 100.0 % (98 of 98) | 100.0 % (49 of 49) | 100.0 % (48 of 48) | 100.0 % (1 of 1) |
Methyl | 100.0 % (86 of 86) | 100.0 % (43 of 43) | 100.0 % (43 of 43) |
1. HP0495
QGHMPSDSKK PTIIYPCLWD YRVIMTTKDT STLKELLETY QRPFKLEFKN TSKNAKFYSF NVSMEVSNES ERNEIFQKIS QLDKVVQTLG SSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM HP0495, U-15N,13C; 10 mM tris, 300 mM NaCl, 1 mM benzamidine, 10 mM DTT, 0.01% NaN3, pH 7.0, 95% H2O, 5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HP0495 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM HP0495, U-15N,13C; 10 mM tris, 300 mM NaCl, 1 mM benzamidine, 10 mM DTT, 0.01% NaN3, pH 7.0, 95% H2O, 5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | HP0495 | [U-13C; U-15N] | 0.5 mM | |
10 | TRIS | natural abundance | 10 mM | |
11 | sodium chloride | natural abundance | 300 mM | |
12 | benzamidine | natural abundance | 1 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.01 % | |
15 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM HP0495, U-15N,13C; 10 mM tris, 300 mM NaCl, 1 mM benzamidine, 10 mM DTT, 0.01% NaN3, pH 7.0, 95% H2O, 5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HP0495 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM HP0495, U-15N,13C; 10 mM tris, 300 mM NaCl, 1 mM benzamidine, 10 mM DTT, 0.01% NaN3, pH 7.0, 95% H2O, 5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HP0495 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM HP0495, U-15N,13C; 10 mM tris, 300 mM NaCl, 1 mM benzamidine, 10 mM DTT, 0.01% NaN3, pH 7.0, 95% H2O, 5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HP0495 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM HP0495, U-15N,13C; 10 mM tris, 300 mM NaCl, 1 mM benzamidine, 10 mM DTT, 0.01% NaN3, pH 7.0, 95% H2O, 5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HP0495 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM HP0495, U-15N,13C; 10 mM tris, 300 mM NaCl, 1 mM benzamidine, 10 mM DTT, 0.01% NaN3, pH 7.0, 95% H2O, 5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HP0495 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM HP0495, U-15N,13C; 10 mM tris, 300 mM NaCl, 1 mM benzamidine, 10 mM DTT, 0.01% NaN3, pH 7.0, 95% H2O, 5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HP0495 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM HP0495, U-15N,13C; 10 mM tris, 300 mM NaCl, 1 mM benzamidine, 10 mM DTT, 0.01% NaN3, pH 7.0, 95% H2O, 5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HP0495 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM HP0495, U-15N,13C; 10 mM tris, 300 mM NaCl, 1 mM benzamidine, 10 mM DTT, 0.01% NaN3, pH 7.0, 95% H2O, 5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HP0495 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM HP0495, U-15N,13C; 10 mM tris, 300 mM NaCl, 1 mM benzamidine, 10 mM DTT, 0.01% NaN3, pH 7.0, 95% H2O, 5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HP0495 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM HP0495, U-15N,13C; 10 mM tris, 300 mM NaCl, 1 mM benzamidine, 10 mM DTT, 0.01% NaN3, pH 7.0, 95% H2O, 5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HP0495 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM HP0495, U-15N,13C; 10 mM tris, 300 mM NaCl, 1 mM benzamidine, 10 mM DTT, 0.01% NaN3, pH 7.0, 95% H2O, 5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HP0495 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM HP0495, U-15N,13C; 10 mM tris, 300 mM NaCl, 1 mM benzamidine, 10 mM DTT, 0.01% NaN3, pH 7.0, 95% H2O, 5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | HP0495 | [U-13C; U-15N] | 0.5 mM | |
10 | TRIS | natural abundance | 10 mM | |
11 | sodium chloride | natural abundance | 300 mM | |
12 | benzamidine | natural abundance | 1 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.01 % | |
15 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM HP0495, U-15N,13C; 10 mM tris, 300 mM NaCl, 1 mM benzamidine, 10 mM DTT, 0.01% NaN3, pH 7.0, 95% H2O, 5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | HP0495 | [U-13C; U-15N] | 0.5 mM | |
10 | TRIS | natural abundance | 10 mM | |
11 | sodium chloride | natural abundance | 300 mM | |
12 | benzamidine | natural abundance | 1 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.01 % | |
15 | D2O | natural abundance | 100 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM HP0495, U-15N,13C; 10 mM tris, 300 mM NaCl, 1 mM benzamidine, 10 mM DTT, 0.01% NaN3, pH 7.0, 95% H2O, 5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HP0495 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | benzamidine | natural abundance | 1 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM HP0495, U-15N,13C; 10 mM tris, 300 mM NaCl, 1 mM benzamidine, 10 mM DTT, 0.01% NaN3, pH 7.0, 95% H2O, 5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | HP0495 | [U-13C; U-15N] | 0.5 mM | |
10 | TRIS | natural abundance | 10 mM | |
11 | sodium chloride | natural abundance | 300 mM | |
12 | benzamidine | natural abundance | 1 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.01 % | |
15 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM HP0495, U-15N,13C; 10 mM tris, 300 mM NaCl, 1 mM benzamidine, 10 mM DTT, 0.01% NaN3, pH 7.0, 95% H2O, 5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | HP0495 | [U-13C; U-15N] | 0.5 mM | |
10 | TRIS | natural abundance | 10 mM | |
11 | sodium chloride | natural abundance | 300 mM | |
12 | benzamidine | natural abundance | 1 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.01 % | |
15 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM HP0495, U-15N,13C; 10 mM tris, 300 mM NaCl, 1 mM benzamidine, 10 mM DTT, 0.01% NaN3, pH 7.0, 95% H2O, 5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | HP0495 | [U-13C; U-15N] | 0.5 mM | |
10 | TRIS | natural abundance | 10 mM | |
11 | sodium chloride | natural abundance | 300 mM | |
12 | benzamidine | natural abundance | 1 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.01 % | |
15 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM HP0495, U-15N,13C; 10 mM tris, 300 mM NaCl, 1 mM benzamidine, 10 mM DTT, 0.01% NaN3, pH 7.0, 95% H2O, 5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | HP0495 | [U-13C; U-15N] | 0.5 mM | |
10 | TRIS | natural abundance | 10 mM | |
11 | sodium chloride | natural abundance | 300 mM | |
12 | benzamidine | natural abundance | 1 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.01 % | |
15 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 0.5 mM HP0495, U-15N,13C; 10 mM tris, 300 mM NaCl, 1 mM benzamidine, 10 mM DTT, 0.01% NaN3, pH 7.0, 95% H2O, 5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | HP0495 | [U-13C; U-15N] | 0.5 mM | |
10 | TRIS | natural abundance | 10 mM | |
11 | sodium chloride | natural abundance | 300 mM | |
12 | benzamidine | natural abundance | 1 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.01 % | |
15 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15190_2joq.nef |
Input source #2: Coordindates | 2joq.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90- QGHMPSDSKKPTIIYPCLWDYRVIMTTKDTSTLKELLETYQRPFKLEFKNTSKNAKFYSFNVSMEVSNESERNEIFQKISQLDKVVQTLGS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| QGHMPSDSKKPTIIYPCLWDYRVIMTTKDTSTLKELLETYQRPFKLEFKNTSKNAKFYSFNVSMEVSNESERNEIFQKISQLDKVVQTLGS
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 91 | 0 | 0 | 100.0 |
Content subtype: combined_15190_2joq.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90- QGHMPSDSKKPTIIYPCLWDYRVIMTTKDTSTLKELLETYQRPFKLEFKNTSKNAKFYSFNVSMEVSNESERNEIFQKISQLDKVVQTLGS ||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||| .GHMPSDSKKPTIIYPCLWDYRVIMTTKDTSTLKELLETYQRPFKLEFKNTS.NAKFYSFNVSMEVSNESERNEIFQKISQLDKVVQTLGS
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
56 | LYS | HZ1 | 6.031 |
56 | LYS | HZ2 | 6.031 |
56 | LYS | HZ3 | 6.031 |
56 | LYS | NZ | 109.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 591 | 558 | 94.4 |
13C chemical shifts | 435 | 413 | 94.9 |
15N chemical shifts | 101 | 90 | 89.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 180 | 170 | 94.4 |
13C chemical shifts | 182 | 168 | 92.3 |
15N chemical shifts | 87 | 80 | 92.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 411 | 388 | 94.4 |
13C chemical shifts | 253 | 245 | 96.8 |
15N chemical shifts | 14 | 10 | 71.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 46 | 46 | 100.0 |
13C chemical shifts | 46 | 46 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 49 | 49 | 100.0 |
13C chemical shifts | 48 | 48 | 100.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90- QGHMPSDSKKPTIIYPCLWDYRVIMTTKDTSTLKELLETYQRPFKLEFKNTSKNAKFYSFNVSMEVSNESERNEIFQKISQLDKVVQTLGS ||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||| ...MPSDSKKPTIIYPCLWDYRVIMTTKDTSTLKELLETYQRPFKLEFKNTS.NAKFYSFNVSMEVSNESERNEIFQKISQLDKVVQTLGS
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90- QGHMPSDSKKPTIIYPCLWDYRVIMTTKDTSTLKELLETYQRPFKLEFKNTSKNAKFYSFNVSMEVSNESERNEIFQKISQLDKVVQTLGS |||| |||||||||||||||||||||||||||||||||||||||||| |||||||||||| |||||||||||| ||||| .GHMP.....PTIIYPCLWDYRVIMTTKDTSTLKELLETYQRPFKLEFKNTS...KFYSFNVSMEVS.ESERNEIFQKIS.....VQTLG --------10--------20--------30--------40--------50--------60--------70--------80--------90