NMR Structure of Clostridium Perfringens Protein CPE0013. Northeast Structural Genomics Target CpR31.
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 88.1 % (894 of 1015) | 88.4 % (467 of 528) | 87.2 % (347 of 398) | 89.9 % (80 of 89) |
Backbone | 89.6 % (450 of 502) | 90.6 % (154 of 170) | 88.8 % (223 of 251) | 90.1 % (73 of 81) |
Sidechain | 87.2 % (518 of 594) | 87.4 % (313 of 358) | 86.8 % (198 of 228) | 87.5 % (7 of 8) |
Aromatic | 44.7 % (34 of 76) | 44.7 % (17 of 38) | 45.9 % (17 of 37) | 0.0 % (0 of 1) |
Methyl | 100.0 % (100 of 100) | 100.0 % (50 of 50) | 100.0 % (50 of 50) |
1. CPE0013
MHKDIFTSVV RVRGSKKYNV VPVKSNKPVE ISKWIDFSNV LSRLYVGVPT KSGNVVCKNI MNTGVDIICT KNLPKDSLEH HHHHHSolvent system 95% H2O/5% D2O, Pressure 1 (±1) atm, Temperature 293 (±1) K, pH 6.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | CaCl2 | natural abundance | 5 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | D2O | natural abundance | 5 % |
Solvent system 100% D2O, Pressure 1 (±1) atm, Temperature 293 (±1) K, pH 6.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | protein | [U-100% 13C; U-100% 15N] | 1 mM | |
9 | MES | natural abundance | 20 mM | |
10 | NaCl | natural abundance | 100 mM | |
11 | DTT | natural abundance | 10 mM | |
12 | CaCl2 | natural abundance | 5 mM | |
13 | NaN3 | natural abundance | 0.02 % |
Solvent system 95% H2O/5% D2O, Pressure 1 (±1) atm, Temperature 293 (±1) K, pH 6.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
14 | protein | [U-5% 13C; U-100% 15N] | 1 mM | |
15 | MES | natural abundance | 20 mM | |
16 | NaCl | natural abundance | 100 mM | |
17 | DTT | natural abundance | 10 mM | |
18 | CaCl2 | natural abundance | 5 mM | |
19 | NaN3 | natural abundance | 0.02 % | |
20 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±1) atm, Temperature 293 (±1) K, pH 6.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | CaCl2 | natural abundance | 5 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±1) atm, Temperature 293 (±1) K, pH 6.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | CaCl2 | natural abundance | 5 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±1) atm, Temperature 293 (±1) K, pH 6.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | CaCl2 | natural abundance | 5 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±1) atm, Temperature 293 (±1) K, pH 6.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | CaCl2 | natural abundance | 5 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±1) atm, Temperature 293 (±1) K, pH 6.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | CaCl2 | natural abundance | 5 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±1) atm, Temperature 293 (±1) K, pH 6.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | CaCl2 | natural abundance | 5 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 (±1) atm, Temperature 293 (±1) K, pH 6.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | protein | [U-100% 13C; U-100% 15N] | 1 mM | |
9 | MES | natural abundance | 20 mM | |
10 | NaCl | natural abundance | 100 mM | |
11 | DTT | natural abundance | 10 mM | |
12 | CaCl2 | natural abundance | 5 mM | |
13 | NaN3 | natural abundance | 0.02 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±1) atm, Temperature 293 (±1) K, pH 6.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
14 | protein | [U-5% 13C; U-100% 15N] | 1 mM | |
15 | MES | natural abundance | 20 mM | |
16 | NaCl | natural abundance | 100 mM | |
17 | DTT | natural abundance | 10 mM | |
18 | CaCl2 | natural abundance | 5 mM | |
19 | NaN3 | natural abundance | 0.02 % | |
20 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±1) atm, Temperature 293 (±1) K, pH 6.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | CaCl2 | natural abundance | 5 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 (±1) atm, Temperature 293 (±1) K, pH 6.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | protein | [U-100% 13C; U-100% 15N] | 1 mM | |
9 | MES | natural abundance | 20 mM | |
10 | NaCl | natural abundance | 100 mM | |
11 | DTT | natural abundance | 10 mM | |
12 | CaCl2 | natural abundance | 5 mM | |
13 | NaN3 | natural abundance | 0.02 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±1) atm, Temperature 293 (±1) K, pH 6.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | CaCl2 | natural abundance | 5 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 (±1) atm, Temperature 293 (±1) K, pH 6.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | CaCl2 | natural abundance | 5 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 (±1) atm, Temperature 293 (±1) K, pH 6.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | protein | [U-100% 13C; U-100% 15N] | 1 mM | |
9 | MES | natural abundance | 20 mM | |
10 | NaCl | natural abundance | 100 mM | |
11 | DTT | natural abundance | 10 mM | |
12 | CaCl2 | natural abundance | 5 mM | |
13 | NaN3 | natural abundance | 0.02 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15203_2jov.nef |
Input source #2: Coordindates | 2jov.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80----- MHKDIFTSVVRVRGSKKYNVVPVKSNKPVEISKWIDFSNVLSRLYVGVPTKSGNVVCKNIMNTGVDIICTKNLPKDSLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MHKDIFTSVVRVRGSKKYNVVPVKSNKPVEISKWIDFSNVLSRLYVGVPTKSGNVVCKNIMNTGVDIICTKNLPKDSLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 85 | 0 | 0 | 100.0 |
Content subtype: combined_15203_2jov.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80----- MHKDIFTSVVRVRGSKKYNVVPVKSNKPVEISKWIDFSNVLSRLYVGVPTKSGNVVCKNIMNTGVDIICTKNLPKDSLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .HKDIFTSVVRVRGSKKYNVVPVKSNKPVEISKWIDFSNVLSRLYVGVPTKSGNVVCKNIMNTGVDIICTKNLPKDSLE --------10--------20--------30--------40--------50--------60--------70---------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 528 | 467 | 88.4 |
13C chemical shifts | 398 | 347 | 87.2 |
15N chemical shifts | 92 | 80 | 87.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 170 | 154 | 90.6 |
13C chemical shifts | 170 | 149 | 87.6 |
15N chemical shifts | 81 | 73 | 90.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 358 | 313 | 87.4 |
13C chemical shifts | 228 | 198 | 86.8 |
15N chemical shifts | 11 | 7 | 63.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 52 | 51 | 98.1 |
13C chemical shifts | 52 | 51 | 98.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 38 | 17 | 44.7 |
13C chemical shifts | 37 | 17 | 45.9 |
15N chemical shifts | 1 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80----- MHKDIFTSVVRVRGSKKYNVVPVKSNKPVEISKWIDFSNVLSRLYVGVPTKSGNVVCKNIMNTGVDIICTKNLPKDSLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..KDIFTSVVRVRGSKKYNVVPVKSNKPVEISKWIDFSNVLSRLYVGVPTKSGNVVCKNIMNTGVDIICTKNLPKDSLE --------10--------20--------30--------40--------50--------60--------70---------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80----- MHKDIFTSVVRVRGSKKYNVVPVKSNKPVEISKWIDFSNVLSRLYVGVPTKSGNVVCKNIMNTGVDIICTKNLPKDSLEHHHHHH ||||||||||||| |||||||| |||||||||||||||| |||| |||| ||||| .HKDIFTSVVRVRG....NVVPVKSN.PVEISKWIDFSNVLSR............VCKN....GVDI..TKNLP --------10--------20--------30--------40--------50--------60--------70----