NMR Structure of 50S Ribosomal Protein L14e from Sulfolobus Solfataricus; Northeast Structural Genomics Consortium Target SSR105.
MPAIEVGRIC VKVKGREAGS KCVIVDIIDD NFVLVTGPKD ITGVKRRRVN ILHLEPTDKK IDIQKGASDE EVKKKLEESN LTEYMKEKIK IRMPTL
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 97.7 % (1126 of 1153) | 97.9 % (597 of 610) | 97.1 % (434 of 447) | 99.0 % (95 of 96) |
Backbone | 98.4 % (559 of 568) | 99.0 % (192 of 194) | 97.9 % (276 of 282) | 98.9 % (91 of 92) |
Sidechain | 97.2 % (656 of 675) | 97.4 % (405 of 416) | 96.9 % (247 of 255) | 100.0 % (4 of 4) |
Aromatic | 77.3 % (17 of 22) | 100.0 % (11 of 11) | 54.5 % (6 of 11) | |
Methyl | 100.0 % (124 of 124) | 100.0 % (62 of 62) | 100.0 % (62 of 62) |
1. 50s ribosomal protein l14e
MPAIEVGRIC VKVKGREAGS KCVIVDIIDD NFVLVTGPKD ITGVKRRRVN ILHLEPTDKK IDIQKGASDE EVKKKLEESN LTEYMKEKIK IRMPTLSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | 90 % | ||
3 | D2O | 10 % |
Pressure 1 atm, Temperature 298 (±1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity | [U-10% 13C; U-99% 15N] | 0.5 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | 90 % | ||
3 | D2O | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | 90 % | ||
3 | D2O | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | 90 % | ||
3 | D2O | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | 90 % | ||
3 | D2O | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | 90 % | ||
3 | D2O | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | 90 % | ||
3 | D2O | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | 90 % | ||
3 | D2O | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | 90 % | ||
3 | D2O | 10 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | H2O | 90 % | ||
3 | D2O | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15210_2joy.nef |
Input source #2: Coordindates | 2joy.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90------ MPAIEVGRICVKVKGREAGSKCVIVDIIDDNFVLVTGPKDITGVKRRRVNILHLEPTDKKIDIQKGASDEEVKKKLEESNLTEYMKEKIKIRMPTL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MPAIEVGRICVKVKGREAGSKCVIVDIIDDNFVLVTGPKDITGVKRRRVNILHLEPTDKKIDIQKGASDEEVKKKLEESNLTEYMKEKIKIRMPTL
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 96 | 0 | 0 | 100.0 |
Content subtype: combined_15210_2joy.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90------ MPAIEVGRICVKVKGREAGSKCVIVDIIDDNFVLVTGPKDITGVKRRRVNILHLEPTDKKIDIQKGASDEEVKKKLEESNLTEYMKEKIKIRMPTL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .PAIEVGRICVKVKGREAGSKCVIVDIIDDNFVLVTGPKDITGVKRRRVNILHLEPTDKKIDIQKGASDEEVKKKLEESNLTEYMKEKIKIRMPTL
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 610 | 596 | 97.7 |
13C chemical shifts | 447 | 432 | 96.6 |
15N chemical shifts | 102 | 95 | 93.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 194 | 192 | 99.0 |
13C chemical shifts | 192 | 186 | 96.9 |
15N chemical shifts | 92 | 91 | 98.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 416 | 404 | 97.1 |
13C chemical shifts | 255 | 246 | 96.5 |
15N chemical shifts | 10 | 4 | 40.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 65 | 63 | 96.9 |
13C chemical shifts | 65 | 63 | 96.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 11 | 11 | 100.0 |
13C chemical shifts | 11 | 6 | 54.5 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90------ MPAIEVGRICVKVKGREAGSKCVIVDIIDDNFVLVTGPKDITGVKRRRVNILHLEPTDKKIDIQKGASDEEVKKKLEESNLTEYMKEKIKIRMPTL ||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .PAIEVGRICVKVK...AGSKCVIVDIIDDNFVLVTGPKDITGVKRRRVNILHLEPTDKKIDIQKGASDEEVKKKLEESNLTEYMKEKIKIRMPTL
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90------ MPAIEVGRICVKVKGREAGSKCVIVDIIDDNFVLVTGPKDITGVKRRRVNILHLEPTDKKIDIQKGASDEEVKKKLEESNLTEYMKEKIKIRMPTL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .PAIEVGRICVKVKGREAGSKCVIVDIIDDNFVLVTGPKDITGVKRRRVNILHLEPTDKKIDIQKGASDEEVKKKLEESNLTEYMKEKIKIRMPTL