chemical shift assignments of PA4090 from Pseudomonas aeruginosa
MGTSHHHHHH SSGRENLYFQ GHMFRSTSHV RTESAARYVN RLCKHWGHKF EVELTPERGF IDFGDSNCEL LAHPDHVLMI LNSPDEDSLA HMQNVVADHL QRMANSESLE IAWQPAES
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 71.9 % (970 of 1350) | 72.6 % (507 of 698) | 70.7 % (372 of 526) | 72.2 % (91 of 126) |
Backbone | 78.1 % (547 of 700) | 76.9 % (183 of 238) | 79.3 % (276 of 348) | 77.2 % (88 of 114) |
Sidechain | 67.7 % (516 of 762) | 70.4 % (324 of 460) | 65.2 % (189 of 290) | 25.0 % (3 of 12) |
Aromatic | 13.7 % (20 of 146) | 24.7 % (18 of 73) | 0.0 % (0 of 71) | 100.0 % (2 of 2) |
Methyl | 98.0 % (98 of 100) | 98.0 % (49 of 50) | 98.0 % (49 of 50) |
1. PA4090
MGTSHHHHHH SSGRENLYFQ GHMFRSTSHV RTESAARYVN RLCKHWGHKF EVELTPERGF IDFGDSNCEL LAHPDHVLMI LNSPDEDSLA HMQNVVADHL QRMANSESLE IAWQPAESSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | MOPS | natural abundance | 10 mM | |
3 | NaCl | natural abundance | 450 mM | |
4 | Zn2+ | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | inhibitor mixture | natural abundance | 1x w/v | |
8 | benzamidine | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | null | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | null | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | null | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | null | indirect | 0.4048086 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | MOPS | natural abundance | 10 mM | |
3 | NaCl | natural abundance | 450 mM | |
4 | Zn2+ | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | inhibitor mixture | natural abundance | 1x w/v | |
8 | benzamidine | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | MOPS | natural abundance | 10 mM | |
3 | NaCl | natural abundance | 450 mM | |
4 | Zn2+ | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | inhibitor mixture | natural abundance | 1x w/v | |
8 | benzamidine | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | MOPS | natural abundance | 10 mM | |
3 | NaCl | natural abundance | 450 mM | |
4 | Zn2+ | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | inhibitor mixture | natural abundance | 1x w/v | |
8 | benzamidine | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | MOPS | natural abundance | 10 mM | |
3 | NaCl | natural abundance | 450 mM | |
4 | Zn2+ | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | inhibitor mixture | natural abundance | 1x w/v | |
8 | benzamidine | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | MOPS | natural abundance | 10 mM | |
3 | NaCl | natural abundance | 450 mM | |
4 | Zn2+ | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | inhibitor mixture | natural abundance | 1x w/v | |
8 | benzamidine | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | MOPS | natural abundance | 10 mM | |
3 | NaCl | natural abundance | 450 mM | |
4 | Zn2+ | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | inhibitor mixture | natural abundance | 1x w/v | |
8 | benzamidine | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | MOPS | natural abundance | 10 mM | |
3 | NaCl | natural abundance | 450 mM | |
4 | Zn2+ | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | inhibitor mixture | natural abundance | 1x w/v | |
8 | benzamidine | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | MOPS | natural abundance | 10 mM | |
3 | NaCl | natural abundance | 450 mM | |
4 | Zn2+ | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | inhibitor mixture | natural abundance | 1x w/v | |
8 | benzamidine | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | MOPS | natural abundance | 10 mM | |
3 | NaCl | natural abundance | 450 mM | |
4 | Zn2+ | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | inhibitor mixture | natural abundance | 1x w/v | |
8 | benzamidine | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | MOPS | natural abundance | 10 mM | |
3 | NaCl | natural abundance | 450 mM | |
4 | Zn2+ | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | inhibitor mixture | natural abundance | 1x w/v | |
8 | benzamidine | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | MOPS | natural abundance | 10 mM | |
3 | NaCl | natural abundance | 450 mM | |
4 | Zn2+ | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | inhibitor mixture | natural abundance | 1x w/v | |
8 | benzamidine | natural abundance | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15246_2jpi.nef |
Input source #2: Coordindates | 2jpi.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
------------------------------10--------20--------30--------40--------50--------60--------70-------- MGTSHHHHHHSSGRENLYFQGHMFRSTSHVRTESAARYVNRLCKHWGHKFEVELTPERGFIDFGDSNCELLAHPDHVLMILNSPDEDSLAHMQNVVADHL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGTSHHHHHHSSGRENLYFQGHMFRSTSHVRTESAARYVNRLCKHWGHKFEVELTPERGFIDFGDSNCELLAHPDHVLMILNSPDEDSLAHMQNVVADHL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 80--------90------ QRMANSESLEIAWQPAES |||||||||||||||||| QRMANSESLEIAWQPAES -------110--------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 118 | 0 | 0 | 100.0 |
Content subtype: combined_15246_2jpi.nef
Assigned chemical shifts
------------------------------10--------20--------30--------40--------50--------60--------70-------- MGTSHHHHHHSSGRENLYFQGHMFRSTSHVRTESAARYVNRLCKHWGHKFEVELTPERGFIDFGDSNCELLAHPDHVLMILNSPDEDSLAHMQNVVADHL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......................MFRSTSHVRTESAARYVNRLCKHWGHKFEVELTPERGFIDFGDSNCELLAHPDHVLMILNSPDEDSLAHMQNVVADHL ------------------------------10--------20--------30--------40--------50--------60--------70-------- 80--------90------ QRMANSESLEIAWQPAES |||| |||||||||||| QRMA.SESLEIAWQPAE 80--------90-----
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 698 | 496 | 71.1 |
13C chemical shifts | 526 | 363 | 69.0 |
15N chemical shifts | 133 | 88 | 66.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 238 | 181 | 76.1 |
13C chemical shifts | 236 | 179 | 75.8 |
15N chemical shifts | 114 | 86 | 75.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 460 | 315 | 68.5 |
13C chemical shifts | 290 | 184 | 63.4 |
15N chemical shifts | 19 | 2 | 10.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 55 | 47 | 85.5 |
13C chemical shifts | 55 | 47 | 85.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 73 | 18 | 24.7 |
13C chemical shifts | 71 | 0 | 0.0 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
------------------------------10--------20--------30--------40--------50--------60--------70-------- MGTSHHHHHHSSGRENLYFQGHMFRSTSHVRTESAARYVNRLCKHWGHKFEVELTPERGFIDFGDSNCELLAHPDHVLMILNSPDEDSLAHMQNVVADHL ||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||| ......................MFRSTSHVRTESAARYVNRLCKHWG.KFEVELTPERGFIDFGDSNCELLAHPDHVLMILNSPDEDSLAHMQNVVADHL ------------------------------10--------20--------30--------40--------50--------60--------70-------- 80--------90------ QRMANSESLEIAWQPAES |||| |||||||||||| QRMA.SESLEIAWQPAE 80--------90-----
Dihedral angle restraints
------------------------------10--------20--------30--------40--------50--------60--------70-------- MGTSHHHHHHSSGRENLYFQGHMFRSTSHVRTESAARYVNRLCKHWGHKFEVELTPERGFIDFGDSNCELLAHPDHVLMILNSPDEDSLAHMQNVVADHL ||||||||||||||||||||||||||||||||||||||||| |||||||| ||||||||||||||||||||||||| ......................MFRSTSHVRTESAARYVNRLCKHWGHKFEVELTPERGFIDF..SNCELLAH..HVLMILNSPDEDSLAHMQNVVADHL ------------------------------10--------20--------30--------40--------50--------60--------70-------- 80--------90------ QRMANSESLEIAWQPAES |||| |||||||||| QRMA.SESLEIAWQP 80--------90---