Solution Structure of T4 Bacteriophage Helicase Uvsw.1
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 76.3 % (700 of 918) | 78.7 % (376 of 478) | 68.2 % (245 of 359) | 97.5 % (79 of 81) |
Backbone | 80.8 % (383 of 474) | 91.4 % (148 of 162) | 67.8 % (158 of 233) | 97.5 % (77 of 79) |
Sidechain | 75.1 % (390 of 519) | 72.2 % (228 of 316) | 79.6 % (160 of 201) | 100.0 % (2 of 2) |
Aromatic | 29.4 % (20 of 68) | 44.1 % (15 of 34) | 14.7 % (5 of 34) | |
Methyl | 85.9 % (67 of 78) | 82.1 % (32 of 39) | 89.7 % (35 of 39) |
1. UvsW.1
GSHMLLEFKQ FLYEASIDEF MGKIASCQTL EGLEELEAYY KKRVKETELK DTDDISVRDA LAGKRAELED SDDEVEESFSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UvsW.1 | [U-99% 13C; U-99% 15N] | 1.66 (±0.1) mM | |
2 | sodium phosphate | 10 mM | ||
3 | NaCl | 10 mM | ||
4 | DTT | 1 mM | ||
5 | sodium azide | 0.02 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.5
Experiment name 2D 1H-15N HSQC, Steady state {1H}-15N NOE
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UvsW.1 | [U-99% 13C; U-99% 15N] | 1.66 (±0.1) mM | |
2 | sodium phosphate | 10 mM | ||
3 | NaCl | 10 mM | ||
4 | DTT | 1 mM | ||
5 | sodium azide | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UvsW.1 | [U-99% 13C; U-99% 15N] | 1.66 (±0.1) mM | |
2 | sodium phosphate | 10 mM | ||
3 | NaCl | 10 mM | ||
4 | DTT | 1 mM | ||
5 | sodium azide | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UvsW.1 | [U-99% 13C; U-99% 15N] | 1.66 (±0.1) mM | |
2 | sodium phosphate | 10 mM | ||
3 | NaCl | 10 mM | ||
4 | DTT | 1 mM | ||
5 | sodium azide | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UvsW.1 | [U-99% 13C; U-99% 15N] | 1.66 (±0.1) mM | |
2 | sodium phosphate | 10 mM | ||
3 | NaCl | 10 mM | ||
4 | DTT | 1 mM | ||
5 | sodium azide | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UvsW.1 | [U-99% 13C; U-99% 15N] | 1.66 (±0.1) mM | |
2 | sodium phosphate | 10 mM | ||
3 | NaCl | 10 mM | ||
4 | DTT | 1 mM | ||
5 | sodium azide | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UvsW.1 | [U-99% 13C; U-99% 15N] | 1.66 (±0.1) mM | |
2 | sodium phosphate | 10 mM | ||
3 | NaCl | 10 mM | ||
4 | DTT | 1 mM | ||
5 | sodium azide | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UvsW.1 | [U-99% 13C; U-99% 15N] | 1.66 (±0.1) mM | |
2 | sodium phosphate | 10 mM | ||
3 | NaCl | 10 mM | ||
4 | DTT | 1 mM | ||
5 | sodium azide | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UvsW.1 | [U-99% 13C; U-99% 15N] | 1.66 (±0.1) mM | |
2 | sodium phosphate | 10 mM | ||
3 | NaCl | 10 mM | ||
4 | DTT | 1 mM | ||
5 | sodium azide | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UvsW.1 | [U-99% 13C; U-99% 15N] | 1.66 (±0.1) mM | |
2 | sodium phosphate | 10 mM | ||
3 | NaCl | 10 mM | ||
4 | DTT | 1 mM | ||
5 | sodium azide | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UvsW.1 | [U-99% 13C; U-99% 15N] | 1.66 (±0.1) mM | |
2 | sodium phosphate | 10 mM | ||
3 | NaCl | 10 mM | ||
4 | DTT | 1 mM | ||
5 | sodium azide | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UvsW.1 | [U-99% 13C; U-99% 15N] | 1.66 (±0.1) mM | |
2 | sodium phosphate | 10 mM | ||
3 | NaCl | 10 mM | ||
4 | DTT | 1 mM | ||
5 | sodium azide | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UvsW.1 | [U-99% 13C; U-99% 15N] | 1.66 (±0.1) mM | |
2 | sodium phosphate | 10 mM | ||
3 | NaCl | 10 mM | ||
4 | DTT | 1 mM | ||
5 | sodium azide | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UvsW.1 | [U-99% 13C; U-99% 15N] | 1.66 (±0.1) mM | |
2 | sodium phosphate | 10 mM | ||
3 | NaCl | 10 mM | ||
4 | DTT | 1 mM | ||
5 | sodium azide | 0.02 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15252_2jpn.nef |
Input source #2: Coordindates | 2jpn.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------- GSHMLLEFKQFLYEASIDEFMGKIASCQTLEGLEELEAYYKKRVKETELKDTDDISVRDALAGKRAELEDSDDEVEESF ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMLLEFKQFLYEASIDEFMGKIASCQTLEGLEELEAYYKKRVKETELKDTDDISVRDALAGKRAELEDSDDEVEESF
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 79 | 0 | 0 | 100.0 |
Content subtype: combined_15252_2jpn.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------- GSHMLLEFKQFLYEASIDEFMGKIASCQTLEGLEELEAYYKKRVKETELKDTDDISVRDALAGKRAELEDSDDEVEESF |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...MLLEFKQFLYEASIDEFMGKIASCQTLEGLEELEAYYKKRVKETELKDTDDISVRDALAGKRAELEDSDDEVEESF
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
16 | SER | HG | 4.79 |
26 | SER | HG | 4.794 |
29 | THR | HG1 | 4.787 |
47 | THR | HG1 | 4.786 |
78 | SER | HG | 4.785 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 478 | 371 | 77.6 |
13C chemical shifts | 359 | 231 | 64.3 |
15N chemical shifts | 84 | 78 | 92.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 162 | 149 | 92.0 |
13C chemical shifts | 158 | 76 | 48.1 |
15N chemical shifts | 79 | 76 | 96.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 316 | 222 | 70.3 |
13C chemical shifts | 201 | 155 | 77.1 |
15N chemical shifts | 5 | 2 | 40.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 41 | 33 | 80.5 |
13C chemical shifts | 41 | 37 | 90.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 34 | 11 | 32.4 |
13C chemical shifts | 34 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------- GSHMLLEFKQFLYEASIDEFMGKIASCQTLEGLEELEAYYKKRVKETELKDTDDISVRDALAGKRAELEDSDDEVEESF ||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...MLL..KQFLYEASIDEFMGKIASCQTLEGLEELEAYYKKRVKETELKDTDDISVRDALAGKRAELEDSDDEVEESF
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------- GSHMLLEFKQFLYEASIDEFMGKIASCQTLEGLEELEAYYKKRVKETELKDTDDISVRDALAGKRAELEDSDDEVEESF ||| |||||||||| ||||||||||||||||||||||||||||| ||||||||||||||||||||| ...MLL.FKQFLYEASI.EFMGKIASCQTLEGLEELEAYYKKRVKET..KDTDDISVRDALAGKRAELED --------10--------20--------30--------40--------50--------60--------70