Antheraea polyphemus pheromone-binding protein 1: structure and assignments at pH 4.5.
SPEIMKNLSN NFGKAMDQCK DELSLPDSVV ADLYNFWKDD YVMTDRLAGC AINCLATKLD VVDPDGNLHH GNAKDFAMKH GADETMAQQL VDIIHGCEKS APPNDDKCMK TIDVAMCFKK EIHKLNWVPN MDLVIGEVLA EV
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS19:SG | 1:CYS54:SG |
2 | disulfide | sing | 1:CYS50:SG | 1:CYS108:SG |
3 | disulfide | sing | 1:CYS97:SG | 1:CYS117:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 98.1 % (1588 of 1618) | 97.7 % (819 of 838) | 98.6 % (620 of 629) | 98.7 % (149 of 151) |
Backbone | 99.2 % (833 of 840) | 98.9 % (282 of 285) | 99.3 % (416 of 419) | 99.3 % (135 of 136) |
Sidechain | 97.5 % (890 of 913) | 97.1 % (537 of 553) | 98.3 % (339 of 345) | 93.3 % (14 of 15) |
Aromatic | 88.0 % (88 of 100) | 88.0 % (44 of 50) | 89.6 % (43 of 48) | 50.0 % (1 of 2) |
Methyl | 97.4 % (148 of 152) | 97.4 % (74 of 76) | 97.4 % (74 of 76) |
1. ApolPBP singlechain
SPEIMKNLSN NFGKAMDQCK DELSLPDSVV ADLYNFWKDD YVMTDRLAGC AINCLATKLD VVDPDGNLHH GNAKDFAMKH GADETMAQQL VDIIHGCEKS APPNDDKCMK TIDVAMCFKK EIHKLNWVPN MDLVIGEVLA EVSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 4.50 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | H2O | 93 % | ||
3 | D2O | 7 % | ||
4 | potassium phosphate | 50 mM | ||
5 | sodium azide | 2 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 900 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 4.50 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | H2O | 93 % | ||
3 | D2O | 7 % | ||
4 | potassium phosphate | 50 mM | ||
5 | sodium azide | 2 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 4.50 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | H2O | 93 % | ||
3 | D2O | 7 % | ||
4 | potassium phosphate | 50 mM | ||
5 | sodium azide | 2 mM |
Bruker DRX - 500 MHz TCI (3-channel) cryoprobe with Z-gradients installed
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 4.50 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | H2O | 93 % | ||
3 | D2O | 7 % | ||
4 | potassium phosphate | 50 mM | ||
5 | sodium azide | 2 mM |
Bruker DRX - 500 MHz TCI (3-channel) cryoprobe with Z-gradients installed
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 4.50 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | H2O | 93 % | ||
3 | D2O | 7 % | ||
4 | potassium phosphate | 50 mM | ||
5 | sodium azide | 2 mM |
Bruker DRX - 500 MHz TCI (3-channel) cryoprobe with Z-gradients installed
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 4.50 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | H2O | 93 % | ||
3 | D2O | 7 % | ||
4 | potassium phosphate | 50 mM | ||
5 | sodium azide | 2 mM |
Bruker DRX - 500 MHz TCI (3-channel) cryoprobe with Z-gradients installed
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 4.50 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | H2O | 93 % | ||
3 | D2O | 7 % | ||
4 | potassium phosphate | 50 mM | ||
5 | sodium azide | 2 mM |
Bruker DRX - 500 MHz TCI (3-channel) cryoprobe with Z-gradients installed
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 4.50 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | H2O | 93 % | ||
3 | D2O | 7 % | ||
4 | potassium phosphate | 50 mM | ||
5 | sodium azide | 2 mM |
Bruker DRX - 500 MHz TCI (3-channel) cryoprobe with Z-gradients installed
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 4.50 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | H2O | 93 % | ||
3 | D2O | 7 % | ||
4 | potassium phosphate | 50 mM | ||
5 | sodium azide | 2 mM |
Bruker DRX - 500 MHz TCI (3-channel) cryoprobe with Z-gradients installed
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 4.50 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | H2O | 93 % | ||
3 | D2O | 7 % | ||
4 | potassium phosphate | 50 mM | ||
5 | sodium azide | 2 mM |
Bruker DRX - 750 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 4.50 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | H2O | 93 % | ||
3 | D2O | 7 % | ||
4 | potassium phosphate | 50 mM | ||
5 | sodium azide | 2 mM |
Bruker DRX - 750 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 4.50 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | H2O | 93 % | ||
3 | D2O | 7 % | ||
4 | potassium phosphate | 50 mM | ||
5 | sodium azide | 2 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 4.50 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | H2O | 93 % | ||
3 | D2O | 7 % | ||
4 | potassium phosphate | 50 mM | ||
5 | sodium azide | 2 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 4.50 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | H2O | 93 % | ||
3 | D2O | 7 % | ||
4 | potassium phosphate | 50 mM | ||
5 | sodium azide | 2 mM |
Bruker DRX - 500 MHz TCI (3-channel) cryoprobe with Z-gradients installed
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 4.50 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | H2O | 93 % | ||
3 | D2O | 7 % | ||
4 | potassium phosphate | 50 mM | ||
5 | sodium azide | 2 mM |
Bruker DRX - 500 MHz TCI (3-channel) cryoprobe with Z-gradients installed
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 4.50 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | H2O | 93 % | ||
3 | D2O | 7 % | ||
4 | potassium phosphate | 50 mM | ||
5 | sodium azide | 2 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15256_2jpo.nef |
Input source #2: Coordindates | 2jpo.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
A:19:CYS:SG | A:54:CYS:SG | oxidized, CA 59.845, CB 40.77 ppm | oxidized, CA 59.724, CB 41.311 ppm | 2.03 |
A:50:CYS:SG | A:108:CYS:SG | oxidized, CA 55.363, CB 34.065 ppm | oxidized, CA 60.86, CB 43.63 ppm | 2.043 |
A:97:CYS:SG | A:117:CYS:SG | oxidized, CA 57.193, CB 38.623 ppm | oxidized, CA 59.718, CB 36.489 ppm | 2.042 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SPEIMKNLSNNFGKAMDQCKDELSLPDSVVADLYNFWKDDYVMTDRLAGCAINCLATKLDVVDPDGNLHHGNAKDFAMKHGADETMAQQLVDIIHGCEKS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SPEIMKNLSNNFGKAMDQCKDELSLPDSVVADLYNFWKDDYVMTDRLAGCAINCLATKLDVVDPDGNLHHGNAKDFAMKHGADETMAQQLVDIIHGCEKS -------110-------120-------130-------140-- APPNDDKCMKTIDVAMCFKKEIHKLNWVPNMDLVIGEVLAEV |||||||||||||||||||||||||||||||||||||||||| APPNDDKCMKTIDVAMCFKKEIHKLNWVPNMDLVIGEVLAEV
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 142 | 0 | 0 | 100.0 |
Content subtype: combined_15256_2jpo.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SPEIMKNLSNNFGKAMDQCKDELSLPDSVVADLYNFWKDDYVMTDRLAGCAINCLATKLDVVDPDGNLHHGNAKDFAMKHGADETMAQQLVDIIHGCEKS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SPEIMKNLSNNFGKAMDQCKDELSLPDSVVADLYNFWKDDYVMTDRLAGCAINCLATKLDVVDPDGNLHHGNAKDFAMKHGADETMAQQLVDIIHGCEKS -------110-------120-------130-------140-- APPNDDKCMKTIDVAMCFKKEIHKLNWVPNMDLVIGEVLAEV |||||||||||||||||||||||||||||||||||||||||| APPNDDKCMKTIDVAMCFKKEIHKLNWVPNMDLVIGEVLAEV
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
46 | ARG | HH11 | 7.056 |
46 | ARG | HH12 | 6.756 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 838 | 829 | 98.9 |
13C chemical shifts | 629 | 620 | 98.6 |
15N chemical shifts | 152 | 150 | 98.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 285 | 284 | 99.6 |
13C chemical shifts | 284 | 281 | 98.9 |
15N chemical shifts | 136 | 135 | 99.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 553 | 545 | 98.6 |
13C chemical shifts | 345 | 339 | 98.3 |
15N chemical shifts | 16 | 15 | 93.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 84 | 83 | 98.8 |
13C chemical shifts | 84 | 83 | 98.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 50 | 44 | 88.0 |
13C chemical shifts | 48 | 43 | 89.6 |
15N chemical shifts | 2 | 1 | 50.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SPEIMKNLSNNFGKAMDQCKDELSLPDSVVADLYNFWKDDYVMTDRLAGCAINCLATKLDVVDPDGNLHHGNAKDFAMKHGADETMAQQLVDIIHGCEKS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SPEIMKNLSNNFGKAMDQCKDELSLPDSVVADLYNFWKDDYVMTDRLAGCAINCLATKLDVVDPDGNLHHGNAKDFAMKHGADETMAQQLVDIIHGCEKS -------110-------120-------130-------140-- APPNDDKCMKTIDVAMCFKKEIHKLNWVPNMDLVIGEVLAEV |||||||||||||||||||||||||||||||||||||||||| APPNDDKCMKTIDVAMCFKKEIHKLNWVPNMDLVIGEVLAEV
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SPEIMKNLSNNFGKAMDQCKDELSLPDSVVADLYNFWKDDYVMTDRLAGCAINCLATKLDVVDPDGNLHHGNAKDFAMKHGADETMAQQLVDIIHGCEKS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SPEIMKNLSNNFGKAMDQCKDELSLPDSVVADLYNFWKDDYVMTDRLAGCAINCLATKLDVVDPDGNLHHGNAKDFAMKHGADETMAQQLVDIIHGCEKS -------110-------120-------130-------140-- APPNDDKCMKTIDVAMCFKKEIHKLNWVPNMDLVIGEVLAEV |||||||||||||||||||||||||||||||||||||||||| APPNDDKCMKTIDVAMCFKKEIHKLNWVPNMDLVIGEVLAEV