NMR solution structure of Vibrio parahaemolyticus VP2129 homodimer. Northeast Structural Genomics target VpR61.
MPITSKYTDE QVEKILAEVA LVLEKHAASP ELTLMIAGNI ATNVLNQRVA ASQRKLIAEK FAQALMSSLE TPKTHLEHHH HHHMPITSKY TDEQVEKILA EVALVLEKHA ASPELTLMIA GNIATNVLNQ RVAASQRKLI AEKFAQALMS SLETPKTHLE HHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 50.4 % (971 of 1928) | 49.6 % (493 of 994) | 50.4 % (383 of 760) | 54.6 % (95 of 174) |
Backbone | 53.2 % (523 of 984) | 52.7 % (173 of 328) | 52.8 % (262 of 496) | 55.0 % (88 of 160) |
Sidechain | 48.1 % (533 of 1108) | 48.0 % (320 of 666) | 48.1 % (206 of 428) | 50.0 % (7 of 14) |
Aromatic | 20.0 % (20 of 100) | 20.0 % (10 of 50) | 20.0 % (10 of 50) | |
Methyl | 55.3 % (126 of 228) | 55.3 % (63 of 114) | 55.3 % (63 of 114) |
1. VP2129
MPITSKYTDE QVEKILAEVA LVLEKHAASP ELTLMIAGNI ATNVLNQRVA ASQRKLIAEK FAQALMSSLE TPKTHLEHHH HHHMPITSKY TDEQVEKILA EVALVLEKHA ASPELTLMIA GNIATNVLNQ RVAASQRKLI AEKFAQALMS SLETPKTHLE HHHHHHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VP2129 | [U-13C; U-15N] | 1.4 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | VP2129 | [U-5% 13C; U-100% 15N] | 1.4 (±0.1) mM | |
10 | sodium chloride | natural abundance | 100 (±5.0) mM | |
11 | calcium chloride | natural abundance | 5 (±0.25) mM | |
12 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
13 | DTT | natural abundance | 10 (±0.5) mM | |
14 | sodium azide | natural abundance | 0.02 (±0.001) % | |
15 | H2O | natural abundance | 95 % | |
16 | D2O | 5 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | VP2129 | [U-13C; U-15N] | 1.4 (±0.1) mM | |
18 | sodium chloride | natural abundance | 100 (±5.0) mM | |
19 | calcium chloride | natural abundance | 5 (±0.25) mM | |
20 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
21 | DTT | natural abundance | 10 (±0.5) mM | |
22 | sodium azide | natural abundance | 0.02 (±0.001) % | |
23 | D2O | 100 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2), Details 50% NC labeled and 50% unlabeled protein mixed together to form mixed homodimer.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
24 | VP2129 | [U-13C; U-15N] | 0.4 (±0.1) mM | |
25 | sodium chloride | natural abundance | 100 (±5.0) mM | |
26 | calcium chloride | natural abundance | 5 (±0.25) mM | |
27 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
28 | DTT | natural abundance | 10 (±0.5) mM | |
29 | sodium azide | natural abundance | 0.02 (±0.001) % | |
30 | VP2129 | natural abundance | 0.4 (±0.1) mM | |
31 | D2O | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VP2129 | [U-13C; U-15N] | 1.4 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VP2129 | [U-13C; U-15N] | 1.4 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VP2129 | [U-13C; U-15N] | 1.4 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VP2129 | [U-13C; U-15N] | 1.4 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VP2129 | [U-13C; U-15N] | 1.4 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | VP2129 | [U-5% 13C; U-100% 15N] | 1.4 (±0.1) mM | |
10 | sodium chloride | natural abundance | 100 (±5.0) mM | |
11 | calcium chloride | natural abundance | 5 (±0.25) mM | |
12 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
13 | DTT | natural abundance | 10 (±0.5) mM | |
14 | sodium azide | natural abundance | 0.02 (±0.001) % | |
15 | H2O | natural abundance | 95 % | |
16 | D2O | 5 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | VP2129 | [U-13C; U-15N] | 1.4 (±0.1) mM | |
18 | sodium chloride | natural abundance | 100 (±5.0) mM | |
19 | calcium chloride | natural abundance | 5 (±0.25) mM | |
20 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
21 | DTT | natural abundance | 10 (±0.5) mM | |
22 | sodium azide | natural abundance | 0.02 (±0.001) % | |
23 | D2O | 100 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | VP2129 | [U-13C; U-15N] | 1.4 (±0.1) mM | |
18 | sodium chloride | natural abundance | 100 (±5.0) mM | |
19 | calcium chloride | natural abundance | 5 (±0.25) mM | |
20 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
21 | DTT | natural abundance | 10 (±0.5) mM | |
22 | sodium azide | natural abundance | 0.02 (±0.001) % | |
23 | D2O | 100 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VP2129 | [U-13C; U-15N] | 1.4 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VP2129 | [U-13C; U-15N] | 1.4 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VP2129 | [U-13C; U-15N] | 1.4 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VP2129 | [U-13C; U-15N] | 1.4 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VP2129 | [U-13C; U-15N] | 1.4 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VP2129 | [U-13C; U-15N] | 1.4 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VP2129 | [U-13C; U-15N] | 1.4 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VP2129 | [U-13C; U-15N] | 1.4 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VP2129 | [U-13C; U-15N] | 1.4 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | VP2129 | [U-13C; U-15N] | 1.4 (±0.1) mM | |
18 | sodium chloride | natural abundance | 100 (±5.0) mM | |
19 | calcium chloride | natural abundance | 5 (±0.25) mM | |
20 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
21 | DTT | natural abundance | 10 (±0.5) mM | |
22 | sodium azide | natural abundance | 0.02 (±0.001) % | |
23 | D2O | 100 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | VP2129 | [U-13C; U-15N] | 1.4 (±0.1) mM | |
18 | sodium chloride | natural abundance | 100 (±5.0) mM | |
19 | calcium chloride | natural abundance | 5 (±0.25) mM | |
20 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
21 | DTT | natural abundance | 10 (±0.5) mM | |
22 | sodium azide | natural abundance | 0.02 (±0.001) % | |
23 | D2O | 100 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2), Details 50% NC labeled and 50% unlabeled protein mixed together to form mixed homodimer.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
24 | VP2129 | [U-13C; U-15N] | 0.4 (±0.1) mM | |
25 | sodium chloride | natural abundance | 100 (±5.0) mM | |
26 | calcium chloride | natural abundance | 5 (±0.25) mM | |
27 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
28 | DTT | natural abundance | 10 (±0.5) mM | |
29 | sodium azide | natural abundance | 0.02 (±0.001) % | |
30 | VP2129 | natural abundance | 0.4 (±0.1) mM | |
31 | D2O | 100 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VP2129 | [U-13C; U-15N] | 1.4 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VP2129 | [U-13C; U-15N] | 1.4 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VP2129 | [U-13C; U-15N] | 1.4 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
5 | DTT | natural abundance | 10 (±0.5) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.001) % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | VP2129 | [U-13C; U-15N] | 1.4 (±0.1) mM | |
18 | sodium chloride | natural abundance | 100 (±5.0) mM | |
19 | calcium chloride | natural abundance | 5 (±0.25) mM | |
20 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
21 | DTT | natural abundance | 10 (±0.5) mM | |
22 | sodium azide | natural abundance | 0.02 (±0.001) % | |
23 | D2O | 100 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | VP2129 | [U-13C; U-15N] | 1.4 (±0.1) mM | |
18 | sodium chloride | natural abundance | 100 (±5.0) mM | |
19 | calcium chloride | natural abundance | 5 (±0.25) mM | |
20 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
21 | DTT | natural abundance | 10 (±0.5) mM | |
22 | sodium azide | natural abundance | 0.02 (±0.001) % | |
23 | D2O | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15258_2jpq.nef |
Input source #2: Coordindates | 2jpq.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--- MPITSKYTDEQVEKILAEVALVLEKHAASPELTLMIAGNIATNVLNQRVAASQRKLIAEKFAQALMSSLETPKTHLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MPITSKYTDEQVEKILAEVALVLEKHAASPELTLMIAGNIATNVLNQRVAASQRKLIAEKFAQALMSSLETPKTHLEHHHHHH
--------10--------20--------30--------40--------50--------60--------70--------80--- MPITSKYTDEQVEKILAEVALVLEKHAASPELTLMIAGNIATNVLNQRVAASQRKLIAEKFAQALMSSLETPKTHLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MPITSKYTDEQVEKILAEVALVLEKHAASPELTLMIAGNIATNVLNQRVAASQRKLIAEKFAQALMSSLETPKTHLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 83 | 0 | 0 | 100.0 |
B | B | 83 | 0 | 0 | 100.0 |
Content subtype: combined_15258_2jpq.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--- MPITSKYTDEQVEKILAEVALVLEKHAASPELTLMIAGNIATNVLNQRVAASQRKLIAEKFAQALMSSLETPKTHLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .PITSKYTDEQVEKILAEVALVLEKHAASPELTLMIAGNIATNVLNQRVAASQRKLIAEKFAQALMSSLETPKTHLEHHHH --------10--------20--------30--------40--------50--------60--------70--------80-
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
48 | ARG | HH11 | 6.87 |
48 | ARG | HH12 | 6.87 |
48 | ARG | HH21 | 6.73 |
48 | ARG | HH22 | 6.73 |
54 | ARG | HH11 | 6.64 |
54 | ARG | HH12 | 6.64 |
54 | ARG | HH21 | 7.17 |
54 | ARG | HH22 | 7.17 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 497 | 461 | 92.8 |
13C chemical shifts | 380 | 348 | 91.6 |
15N chemical shifts | 89 | 86 | 96.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 164 | 156 | 95.1 |
13C chemical shifts | 166 | 155 | 93.4 |
15N chemical shifts | 80 | 77 | 96.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 333 | 305 | 91.6 |
13C chemical shifts | 214 | 193 | 90.2 |
15N chemical shifts | 9 | 9 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 60 | 59 | 98.3 |
13C chemical shifts | 60 | 59 | 98.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 25 | 10 | 40.0 |
13C chemical shifts | 25 | 10 | 40.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--- MPITSKYTDEQVEKILAEVALVLEKHAASPELTLMIAGNIATNVLNQRVAASQRKLIAEKFAQALMSSLETPKTHLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | ..ITSKYTDEQVEKILAEVALVLEKHAASPELTLMIAGNIATNVLNQRVAASQRKLIAEKFAQALMSSLETPKT.L --------10--------20--------30--------40--------50--------60--------70------
--------10--------20--------30--------40--------50--------60--------70--------80--- MPITSKYTDEQVEKILAEVALVLEKHAASPELTLMIAGNIATNVLNQRVAASQRKLIAEKFAQALMSSLETPKTHLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | ..ITSKYTDEQVEKILAEVALVLEKHAASPELTLMIAGNIATNVLNQRVAASQRKLIAEKFAQALMSSLETPKT.L --------10--------20--------30--------40--------50--------60--------70------
--------10--------20--------30--------40--------50--------60--------70--------80--- MPITSKYTDEQVEKILAEVALVLEKHAASPELTLMIAGNIATNVLNQRVAASQRKLIAEKFAQALMSSLETPKTHLEHHHHHH ||||||||||||| | ||||||||||||||||| |||||||||||||||| ........DEQVEKILAEVAL..E......ELTLMIAGNIATNVLNQ.....QRKLIAEKFAQALMSS --------10--------20--------30--------40--------50--------60--------
--------10--------20--------30--------40--------50--------60--------70--------80--- MPITSKYTDEQVEKILAEVALVLEKHAASPELTLMIAGNIATNVLNQRVAASQRKLIAEKFAQALMSSLETPKTHLEHHHHHH ||||||||||||| | ||||||||||||||||| |||||||||||||||| ........DEQVEKILAEVAL..E......ELTLMIAGNIATNVLNQ.....QRKLIAEKFAQALMSS --------10--------20--------30--------40--------50--------60--------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--- MPITSKYTDEQVEKILAEVALVLEKHAASPELTLMIAGNIATNVLNQRVAASQRKLIAEKFAQALMSSLETPKTHLEHHHHHH ||||||||||||||||||| ||||||||||||||||||| ||||||||||||||||||| .......TDEQVEKILAEVALVLEKH..SPELTLMIAGNIATNVLNQ..AASQRKLIAEKFAQALMSS --------10--------20--------30--------40--------50--------60--------
--------10--------20--------30--------40--------50--------60--------70--------80--- MPITSKYTDEQVEKILAEVALVLEKHAASPELTLMIAGNIATNVLNQRVAASQRKLIAEKFAQALMSSLETPKTHLEHHHHHH ||||||||||||||||||| ||||||||||||||||||| ||||||||||||||||||| .......TDEQVEKILAEVALVLEKH..SPELTLMIAGNIATNVLNQ..AASQRKLIAEKFAQALMSS --------10--------20--------30--------40--------50--------60--------