NMR solution structure of Bacillus subtilis YobA 21-120: Northeast Structural Genomics Consortium target SR547
MNKNEQNGDE TKMQSLVGYV VLKDNERAIL ITDTKAPGKE DYNLSEGQLM NKFKNNIVIV GLSEIDNTDD LKRGEKIKVW FHTRKESNPP SATIQKYELL LEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.4 % (1187 of 1299) | 91.1 % (622 of 683) | 90.7 % (450 of 496) | 95.8 % (115 of 120) |
Backbone | 93.6 % (601 of 642) | 92.7 % (203 of 219) | 93.7 % (298 of 318) | 95.2 % (100 of 105) |
Sidechain | 89.9 % (682 of 759) | 90.3 % (419 of 464) | 88.6 % (248 of 280) | 100.0 % (15 of 15) |
Aromatic | 48.8 % (41 of 84) | 52.4 % (22 of 42) | 43.9 % (18 of 41) | 100.0 % (1 of 1) |
Methyl | 96.4 % (106 of 110) | 96.4 % (53 of 55) | 96.4 % (53 of 55) |
1. YobA 21-120
MNKNEQNGDE TKMQSLVGYV VLKDNERAIL ITDTKAPGKE DYNLSEGQLM NKFKNNIVIV GLSEIDNTDD LKRGEKIKVW FHTRKESNPP SATIQKYELL LEHHHHHHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | dithiothreitol | natural abundance | 10 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | ammonium acetate | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5, Details 13C from 5% 13C-glucose in growth medium
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | [5% 13C; U-100% N15] | 0.79 mM | |
10 | dithiothreitol | natural abundance | 10 mM | |
11 | calcium chloride | natural abundance | 5 mM | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | ammonium acetate | natural abundance | 20 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | H2O | natural abundance | 95 % | |
16 | D2O | 5 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | entity | [U-100% 13C; U-100% 15N] | 0.75 mM | |
18 | dithiothreitol | natural abundance | 10 mM | |
19 | calcium chloride | natural abundance | 5 mM | |
20 | sodium chloride | natural abundance | 100 mM | |
21 | ammonium acetate | natural abundance | 20 mM | |
22 | sodium azide | natural abundance | 0.02 % | |
23 | D2O | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | dithiothreitol | natural abundance | 10 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | ammonium acetate | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5, Details 13C from 5% 13C-glucose in growth medium
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | [5% 13C; U-100% N15] | 0.79 mM | |
10 | dithiothreitol | natural abundance | 10 mM | |
11 | calcium chloride | natural abundance | 5 mM | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | ammonium acetate | natural abundance | 20 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | H2O | natural abundance | 95 % | |
16 | D2O | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | dithiothreitol | natural abundance | 10 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | ammonium acetate | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | dithiothreitol | natural abundance | 10 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | ammonium acetate | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | dithiothreitol | natural abundance | 10 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | ammonium acetate | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | dithiothreitol | natural abundance | 10 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | ammonium acetate | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | dithiothreitol | natural abundance | 10 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | ammonium acetate | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | dithiothreitol | natural abundance | 10 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | ammonium acetate | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | dithiothreitol | natural abundance | 10 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | ammonium acetate | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | dithiothreitol | natural abundance | 10 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | ammonium acetate | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | dithiothreitol | natural abundance | 10 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | ammonium acetate | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | entity | [U-100% 13C; U-100% 15N] | 0.75 mM | |
18 | dithiothreitol | natural abundance | 10 mM | |
19 | calcium chloride | natural abundance | 5 mM | |
20 | sodium chloride | natural abundance | 100 mM | |
21 | ammonium acetate | natural abundance | 20 mM | |
22 | sodium azide | natural abundance | 0.02 % | |
23 | D2O | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15288_2jqo.nef |
Input source #2: Coordindates | 2jqo.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MNKNEQNGDETKMQSLVGYVVLKDNERAILITDTKAPGKEDYNLSEGQLMNKFKNNIVIVGLSEIDNTDDLKRGEKIKVWFHTRKESNPPSATIQKYELL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MNKNEQNGDETKMQSLVGYVVLKDNERAILITDTKAPGKEDYNLSEGQLMNKFKNNIVIVGLSEIDNTDDLKRGEKIKVWFHTRKESNPPSATIQKYELL -------- LEHHHHHH |||||||| LEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 108 | 0 | 0 | 100.0 |
Content subtype: combined_15288_2jqo.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MNKNEQNGDETKMQSLVGYVVLKDNERAILITDTKAPGKEDYNLSEGQLMNKFKNNIVIVGLSEIDNTDDLKRGEKIKVWFHTRKESNPPSATIQKYELL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MNKNEQNGDETKMQSLVGYVVLKDNERAILITDTKAPGKEDYNLSEGQLMNKFKNNIVIVGLSEIDNTDDLKRGEKIKVWFHTRKESNPPSATIQKYELL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------- LEHHHHHH ||| LEH ---
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 683 | 635 | 93.0 |
13C chemical shifts | 496 | 456 | 91.9 |
15N chemical shifts | 123 | 117 | 95.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 219 | 207 | 94.5 |
13C chemical shifts | 216 | 205 | 94.9 |
15N chemical shifts | 105 | 99 | 94.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 464 | 428 | 92.2 |
13C chemical shifts | 280 | 251 | 89.6 |
15N chemical shifts | 18 | 18 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 58 | 58 | 100.0 |
13C chemical shifts | 58 | 58 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 42 | 18 | 42.9 |
13C chemical shifts | 41 | 17 | 41.5 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MNKNEQNGDETKMQSLVGYVVLKDNERAILITDTKAPGKEDYNLSEGQLMNKFKNNIVIVGLSEIDNTDDLKRGEKIKVWFHTRKESNPPSATIQKYELL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .........ETKMQSLVGYVVLKDNERAILITDTKAPGKEDYNLSEGQLMNKFKNNIVIVGLSEIDNTDDLKRGEKIKVWFHTRKESNPPSATIQKYELL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------- LEHHHHHH || LE --
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MNKNEQNGDETKMQSLVGYVVLKDNERAILITDTKAPGKEDYNLSEGQLMNKFKNNIVIVGLSEIDNTDDLKRGEKIKVWFHTRKESNPPSATIQKYELL |||||||||||| |||||| |||||||||||||| ||||| ||| ||||||| ||||||||||| |||| ||||| ............MQSLVGYVVLKD.ERAILI......GKEDYNLSEGQLMN....NIVIV.LSE..NTDDLKR..KIKVWFHTRKE...PSAT..KYELL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------- LEHHHHHH