Solution structure of Saccharomyces cerevisiae conserved oligomeric Golgi subunit 2 protein (Cog2p)
GSDSLIRDLS GLSQKMVQTL LEQIRSNYDD YLTFSNTYTD EENETLINLE KTQSDLQKFM TQLDHLIKDD ISNTQEIIKD VLEYLKKLDE IYGSLRNHSQ LTEALSLGKR LSKSLHEMCG IEPLEEEICS GLIEQLYKLI TASRRILESC ADSNSPYIHH LRNDYQDLLQ EFQISLKILT EKCLENPSSL QNLSLTLVSI IKTA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.1 % (2213 of 2428) | 90.8 % (1149 of 1266) | 91.5 % (858 of 938) | 92.0 % (206 of 224) |
Backbone | 92.0 % (1120 of 1218) | 92.7 % (381 of 411) | 90.8 % (550 of 606) | 94.0 % (189 of 201) |
Sidechain | 90.8 % (1279 of 1408) | 89.9 % (769 of 855) | 93.0 % (493 of 530) | 73.9 % (17 of 23) |
Aromatic | 96.5 % (110 of 114) | 96.5 % (55 of 57) | 96.5 % (55 of 57) | |
Methyl | 94.6 % (244 of 258) | 94.6 % (122 of 129) | 94.6 % (122 of 129) |
1. Cog2p
GSDSLIRDLS GLSQKMVQTL LEQIRSNYDD YLTFSNTYTD EENETLINLE KTQSDLQKFM TQLDHLIKDD ISNTQEIIKD VLEYLKKLDE IYGSLRNHSQ LTEALSLGKR LSKSLHEMCG IEPLEEEICS GLIEQLYKLI TASRRILESC ADSNSPYIHH LRNDYQDLLQ EFQISLKILT EKCLENPSSL QNLSLTLVSI IKTASolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7, Details Primary sample
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cog2p | [U-100% 13C; U-100% 15N] | 1 (±0.05) mM | |
2 | TRIS | natural abundance | 3 (±0.05) mM | |
3 | EDTA | natural abundance | 50 (±0.05) uM | |
4 | sodium chloride | natural abundance | 10 (±0.05) mM | |
5 | sodium azide | natural abundance | 0.0025 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 7, Details same as for sample 1, but with D2O as solvent system
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Cog2p | [U-100% 13C; U-100% 15N] | 1 (±0.05) mM | |
7 | TRIS | natural abundance | 3 (±0.05) mM | |
8 | EDTA | natural abundance | 50 (±0.05) uM | |
9 | sodium chloride | natural abundance | 10 (±0.05) mM | |
10 | sodium azide | natural abundance | 0.0025 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7, Details To determine stereospecificity of leucine side chains
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Cog2p | [U-10% 13C; U-100% 15N] | 1 (±0.05) mM | |
12 | TRIS | natural abundance | 3 (±0.05) mM | |
13 | EDTA | natural abundance | 50 (±0.05) uM | |
14 | sodium chloride | natural abundance | 10 (±0.05) mM | |
15 | sodium azide | natural abundance | 0.0025 (±0.05) % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.25146 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.10134 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.25146 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.10134 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.25146 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.10134 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.25146 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.10134 |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7, Details Primary sample
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cog2p | [U-100% 13C; U-100% 15N] | 1 (±0.05) mM | |
2 | TRIS | natural abundance | 3 (±0.05) mM | |
3 | EDTA | natural abundance | 50 (±0.05) uM | |
4 | sodium chloride | natural abundance | 10 (±0.05) mM | |
5 | sodium azide | natural abundance | 0.0025 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7, Details Primary sample
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cog2p | [U-100% 13C; U-100% 15N] | 1 (±0.05) mM | |
2 | TRIS | natural abundance | 3 (±0.05) mM | |
3 | EDTA | natural abundance | 50 (±0.05) uM | |
4 | sodium chloride | natural abundance | 10 (±0.05) mM | |
5 | sodium azide | natural abundance | 0.0025 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7, Details Primary sample
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cog2p | [U-100% 13C; U-100% 15N] | 1 (±0.05) mM | |
2 | TRIS | natural abundance | 3 (±0.05) mM | |
3 | EDTA | natural abundance | 50 (±0.05) uM | |
4 | sodium chloride | natural abundance | 10 (±0.05) mM | |
5 | sodium azide | natural abundance | 0.0025 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 7, Details same as for sample 1, but with D2O as solvent system
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Cog2p | [U-100% 13C; U-100% 15N] | 1 (±0.05) mM | |
7 | TRIS | natural abundance | 3 (±0.05) mM | |
8 | EDTA | natural abundance | 50 (±0.05) uM | |
9 | sodium chloride | natural abundance | 10 (±0.05) mM | |
10 | sodium azide | natural abundance | 0.0025 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7, Details Primary sample
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cog2p | [U-100% 13C; U-100% 15N] | 1 (±0.05) mM | |
2 | TRIS | natural abundance | 3 (±0.05) mM | |
3 | EDTA | natural abundance | 50 (±0.05) uM | |
4 | sodium chloride | natural abundance | 10 (±0.05) mM | |
5 | sodium azide | natural abundance | 0.0025 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7, Details Primary sample
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cog2p | [U-100% 13C; U-100% 15N] | 1 (±0.05) mM | |
2 | TRIS | natural abundance | 3 (±0.05) mM | |
3 | EDTA | natural abundance | 50 (±0.05) uM | |
4 | sodium chloride | natural abundance | 10 (±0.05) mM | |
5 | sodium azide | natural abundance | 0.0025 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7, Details Primary sample
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cog2p | [U-100% 13C; U-100% 15N] | 1 (±0.05) mM | |
2 | TRIS | natural abundance | 3 (±0.05) mM | |
3 | EDTA | natural abundance | 50 (±0.05) uM | |
4 | sodium chloride | natural abundance | 10 (±0.05) mM | |
5 | sodium azide | natural abundance | 0.0025 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7, Details Primary sample
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cog2p | [U-100% 13C; U-100% 15N] | 1 (±0.05) mM | |
2 | TRIS | natural abundance | 3 (±0.05) mM | |
3 | EDTA | natural abundance | 50 (±0.05) uM | |
4 | sodium chloride | natural abundance | 10 (±0.05) mM | |
5 | sodium azide | natural abundance | 0.0025 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7, Details Primary sample
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cog2p | [U-100% 13C; U-100% 15N] | 1 (±0.05) mM | |
2 | TRIS | natural abundance | 3 (±0.05) mM | |
3 | EDTA | natural abundance | 50 (±0.05) uM | |
4 | sodium chloride | natural abundance | 10 (±0.05) mM | |
5 | sodium azide | natural abundance | 0.0025 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 7, Details To determine stereospecificity of leucine side chains
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Cog2p | [U-10% 13C; U-100% 15N] | 1 (±0.05) mM | |
12 | TRIS | natural abundance | 3 (±0.05) mM | |
13 | EDTA | natural abundance | 50 (±0.05) uM | |
14 | sodium chloride | natural abundance | 10 (±0.05) mM | |
15 | sodium azide | natural abundance | 0.0025 (±0.05) % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15290_2jqq.nef |
Input source #2: Coordindates | 2jqq.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-60-------70--------80--------90-------100-------110-------120-------130-------140-------150-------1 GSDSLIRDLSGLSQKMVQTLLEQIRSNYDDYLTFSNTYTDEENETLINLEKTQSDLQKFMTQLDHLIKDDISNTQEIIKDVLEYLKKLDEIYGSLRNHSQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSDSLIRDLSGLSQKMVQTLLEQIRSNYDDYLTFSNTYTDEENETLINLEKTQSDLQKFMTQLDHLIKDDISNTQEIIKDVLEYLKKLDEIYGSLRNHSQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 60-------170-------180-------190-------200-------210-------220-------230-------240-------250-------2 LTEALSLGKRLSKSLHEMCGIEPLEEEICSGLIEQLYKLITASRRILESCADSNSPYIHHLRNDYQDLLQEFQISLKILTEKCLENPSSLQNLSLTLVSI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| LTEALSLGKRLSKSLHEMCGIEPLEEEICSGLIEQLYKLITASRRILESCADSNSPYIHHLRNDYQDLLQEFQISLKILTEKCLENPSSLQNLSLTLVSI -------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 60-- IKTA |||| IKTA ----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 204 | 0 | 0 | 100.0 |
Content subtype: combined_15290_2jqq.nef
Assigned chemical shifts
-60-------70--------80--------90-------100-------110-------120-------130-------140-------150-------1 GSDSLIRDLSGLSQKMVQTLLEQIRSNYDDYLTFSNTYTDEENETLINLEKTQSDLQKFMTQLDHLIKDDISNTQEIIKDVLEYLKKLDEIYGSLRNHSQ ||||||||||| ||||||||| ||| | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | ..DSLIRDLSGLS.KMVQTLLEQ..SNY..Y..FSNTYTDEENETLINLEKTQSDLQKFMTQLDHLIKDDISNTQEIIKDVLEYLKKLDEIYGSLRN..Q 60-------170-------180-------190-------200-------210-------220-------230-------240-------250-------2 LTEALSLGKRLSKSLHEMCGIEPLEEEICSGLIEQLYKLITASRRILESCADSNSPYIHHLRNDYQDLLQEFQISLKILTEKCLENPSSLQNLSLTLVSI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| LTEALSLGKRLSKSLHEMCGIEPLEEEICSGLIEQLYKLITASRRILESCADSNSPYIHHLRNDYQDLLQEFQISLKILTEKCLENPSSLQNLSLTLVSI 60-- IKTA | || I.TA
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1266 | 1145 | 90.4 |
13C chemical shifts | 938 | 846 | 90.2 |
15N chemical shifts | 231 | 205 | 88.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 411 | 378 | 92.0 |
13C chemical shifts | 408 | 356 | 87.3 |
15N chemical shifts | 201 | 188 | 93.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 855 | 767 | 89.7 |
13C chemical shifts | 530 | 490 | 92.5 |
15N chemical shifts | 30 | 17 | 56.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 132 | 125 | 94.7 |
13C chemical shifts | 132 | 125 | 94.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 57 | 55 | 96.5 |
13C chemical shifts | 57 | 55 | 96.5 |
Distance restraints
-60-------70--------80--------90-------100-------110-------120-------130-------140-------150-------1 GSDSLIRDLSGLSQKMVQTLLEQIRSNYDDYLTFSNTYTDEENETLINLEKTQSDLQKFMTQLDHLIKDDISNTQEIIKDVLEYLKKLDEIYGSLRNHSQ ||||||||||||||||||||||||||||||||||||||||||||||| | ..................................................KTQSDLQKFMTQLDHLIKDDISNTQEIIKDVLEYLKKLDEIYGSLRN..Q 60-------170-------180-------190-------200-------210-------220-------230-------240-------250-------2 LTEALSLGKRLSKSLHEMCGIEPLEEEICSGLIEQLYKLITASRRILESCADSNSPYIHHLRNDYQDLLQEFQISLKILTEKCLENPSSLQNLSLTLVSI |||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||| LTEALSLGKRLSKSLHEMCGIEPLEEEICSGLIEQLYKLITASRRILESCAD..SPYIHHLRNDYQDLLQEFQISLKILTEKCLENPSSLQNLSLTLVSI 60-- IKTA | || I.TA
-60-------70--------80--------90-------100-------110-------120-------130-------140-------150-------1 GSDSLIRDLSGLSQKMVQTLLEQIRSNYDDYLTFSNTYTDEENETLINLEKTQSDLQKFMTQLDHLIKDDISNTQEIIKDVLEYLKKLDEIYGSLRNHSQ ||||||||||||||||||||||| ||||||||||||||||||| ...............................................NLEKTQSDLQKFMTQLDHLIKDD...TQEIIKDVLEYLKKLDEIY........ -60-------70--------80--------90-------100-------110-------120-------130-------140-------150-------1 60-------170-------180-------190-------200-------210-------220-------230-------240-------250-------2 LTEALSLGKRLSKSLHEMCGIEPLEEEICSGLIEQLYKLITASRRILESCADSNSPYIHHLRNDYQDLLQEFQISLKILTEKCLENPSSLQNLSLTLVSI |||||||||||||||||| ||||||||||||||||||||||| |||||||||||||||||||||||||||| |||||||||| LTEALSLGKRLSKSLHEM........EICSGLIEQLYKLITASRRILES.......YIHHLRNDYQDLLQEFQISLKILTEKCL......QNLSLTLVSI 60-------170-------180-------190-------200-------210-------220-------230-------240-------250-------- 60-- IKTA
Dihedral angle restraints
-60-------70--------80--------90-------100-------110-------120-------130-------140-------150-------1 GSDSLIRDLSGLSQKMVQTLLEQIRSNYDDYLTFSNTYTDEENETLINLEKTQSDLQKFMTQLDHLIKDDISNTQEIIKDVLEYLKKLDEIYGSLRNHSQ ||||||||||||||||||| |||||||||||||||||||||| || .................................................EKTQSDLQKFMTQLDHLIK...SNTQEIIKDVLEYLKKLDEIYG.....SQ -60-------70--------80--------90-------100-------110-------120-------130-------140-------150-------1 60-------170-------180-------190-------200-------210-------220-------230-------240-------250-------2 LTEALSLGKRLSKSLHEMCGIEPLEEEICSGLIEQLYKLITASRRILESCADSNSPYIHHLRNDYQDLLQEFQISLKILTEKCLENPSSLQNLSLTLVSI |||||||||||||||||||| |||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||| LTEALSLGKRLSKSLHEMCG.EPLEEEICSGLIEQLYKLITASRRILESCA...SPYIHHLRNDYQDLLQEFQISLKILTEKCLENPSSLQNLSLTLVSI 60-------170-------180-------190-------200-------210-------220-------230-------240-------250-------- 60-- IKTA | I -