Solution structure of NusB from Aquifex Aeolicus
MRYRKGARDT AFLVLYRWDL RGENPGELFK EVVEEKNIKN KDAYEYAKKL VDTAVRHIEE IDSIIEKHLK GWSIDRLGYV ERNALRLGVA ELIFLKSKEP GRVFIDIVDL VKKYADEKAG KFVNGVLSAI YKAYITSSKE EKPSLKSE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.7 % (1679 of 1811) | 91.9 % (873 of 950) | 93.2 % (661 of 709) | 95.4 % (145 of 152) |
Backbone | 94.9 % (837 of 882) | 95.4 % (288 of 302) | 94.0 % (409 of 435) | 96.6 % (140 of 145) |
Sidechain | 91.4 % (976 of 1068) | 90.3 % (585 of 648) | 93.5 % (386 of 413) | 71.4 % (5 of 7) |
Aromatic | 89.0 % (130 of 146) | 89.0 % (65 of 73) | 91.5 % (65 of 71) | 0.0 % (0 of 2) |
Methyl | 97.7 % (172 of 176) | 100.0 % (88 of 88) | 95.5 % (84 of 88) |
1. NusB
MRYRKGARDT AFLVLYRWDL RGENPGELFK EVVEEKNIKN KDAYEYAKKL VDTAVRHIEE IDSIIEKHLK GWSIDRLGYV ERNALRLGVA ELIFLKSKEP GRVFIDIVDL VKKYADEKAG KFVNGVLSAI YKAYITSSKE EKPSLKSESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308.15 K, pH 6.8, Details 0.7 mM Aquifex Aeolicus NusB
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aquifex NusB monomer | [U-13C; U-15N] | 0.7 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 200 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | water | protons | 4.677 ppm | internal | direct | 1.0 |
15N | water | protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | water | protons | 4.677 ppm | internal | direct | 1.0 |
15N | water | protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | water | protons | 4.677 ppm | internal | direct | 1.0 |
15N | water | protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | water | protons | 4.677 ppm | internal | direct | 1.0 |
15N | water | protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308.15 K, pH 6.8, Details 0.7 mM Aquifex Aeolicus NusB
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aquifex NusB monomer | [U-13C; U-15N] | 0.7 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 200 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308.15 K, pH 6.8, Details 0.7 mM Aquifex Aeolicus NusB
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aquifex NusB monomer | [U-13C; U-15N] | 0.7 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 200 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308.15 K, pH 6.8, Details 0.7 mM Aquifex Aeolicus NusB
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aquifex NusB monomer | [U-13C; U-15N] | 0.7 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 200 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308.15 K, pH 6.8, Details 0.7 mM Aquifex Aeolicus NusB
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aquifex NusB monomer | [U-13C; U-15N] | 0.7 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 200 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308.15 K, pH 6.8, Details 0.7 mM Aquifex Aeolicus NusB
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aquifex NusB monomer | [U-13C; U-15N] | 0.7 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 200 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308.15 K, pH 6.8, Details 0.7 mM Aquifex Aeolicus NusB
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aquifex NusB monomer | [U-13C; U-15N] | 0.7 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 200 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308.15 K, pH 6.8, Details 0.7 mM Aquifex Aeolicus NusB
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aquifex NusB monomer | [U-13C; U-15N] | 0.7 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 200 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308.15 K, pH 6.8, Details 0.7 mM Aquifex Aeolicus NusB
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aquifex NusB monomer | [U-13C; U-15N] | 0.7 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 200 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308.15 K, pH 6.8, Details 0.7 mM Aquifex Aeolicus NusB
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aquifex NusB monomer | [U-13C; U-15N] | 0.7 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 200 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308.15 K, pH 6.8, Details 0.7 mM Aquifex Aeolicus NusB
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aquifex NusB monomer | [U-13C; U-15N] | 0.7 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 200 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308.15 K, pH 6.8, Details 0.7 mM Aquifex Aeolicus NusB
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aquifex NusB monomer | [U-13C; U-15N] | 0.7 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 200 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308.15 K, pH 6.8, Details 0.7 mM Aquifex Aeolicus NusB
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aquifex NusB monomer | [U-13C; U-15N] | 0.7 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 200 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308.15 K, pH 6.8, Details 0.7 mM Aquifex Aeolicus NusB
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Aquifex NusB monomer | [U-13C; U-15N] | 0.7 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 200 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_15312_2jr0.nef |
Input source #2: Coordindates | 2jr0.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRYRKGARDTAFLVLYRWDLRGENPGELFKEVVEEKNIKNKDAYEYAKKLVDTAVRHIEEIDSIIEKHLKGWSIDRLGYVERNALRLGVAELIFLKSKEP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MRYRKGARDTAFLVLYRWDLRGENPGELFKEVVEEKNIKNKDAYEYAKKLVDTAVRHIEEIDSIIEKHLKGWSIDRLGYVERNALRLGVAELIFLKSKEP -------110-------120-------130-------140-------- GRVFIDIVDLVKKYADEKAGKFVNGVLSAIYKAYITSSKEEKPSLKSE |||||||||||||||||||||||||||||||||||||||||||||||| GRVFIDIVDLVKKYADEKAGKFVNGVLSAIYKAYITSSKEEKPSLKSE
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 148 | 0 | 0 | 100.0 |
Content subtype: combined_15312_2jr0.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRYRKGARDTAFLVLYRWDLRGENPGELFKEVVEEKNIKNKDAYEYAKKLVDTAVRHIEEIDSIIEKHLKGWSIDRLGYVERNALRLGVAELIFLKSKEP | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| M.YRKGARDTAFLVLYRWDLRGENPGELFKEVVEEKNIKNKDAYEYAKKLVDTAVRHIEEIDSIIEKHLKGWSIDRLGYVERNALRLGVAELIFLKSKEP -------110-------120-------130-------140-------- GRVFIDIVDLVKKYADEKAGKFVNGVLSAIYKAYITSSKEEKPSLKSE |||||||||||||||||||||||||||||||||||||||||||||||| GRVFIDIVDLVKKYADEKAGKFVNGVLSAIYKAYITSSKEEKPSLKSE
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 950 | 856 | 90.1 |
13C chemical shifts | 709 | 656 | 92.5 |
15N chemical shifts | 162 | 143 | 88.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 302 | 282 | 93.4 |
13C chemical shifts | 296 | 274 | 92.6 |
15N chemical shifts | 145 | 138 | 95.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 648 | 574 | 88.6 |
13C chemical shifts | 413 | 382 | 92.5 |
15N chemical shifts | 17 | 5 | 29.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 89 | 87 | 97.8 |
13C chemical shifts | 89 | 84 | 94.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 73 | 65 | 89.0 |
13C chemical shifts | 71 | 65 | 91.5 |
15N chemical shifts | 2 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRYRKGARDTAFLVLYRWDLRGENPGELFKEVVEEKNIKNKDAYEYAKKLVDTAVRHIEEIDSIIEKHLKGWSIDRLGYVERNALRLGVAELIFLKSKEP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..YRKGARDTAFLVLYRWDLRGENPGELFKEVVEEKNIKNKDAYEYAKKLVDTAVRHIEEIDSIIEKHLKGWSIDRLGYVERNALRLGVAELIFLKSKEP --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------- GRVFIDIVDLVKKYADEKAGKFVNGVLSAIYKAYITSSKEEKPSLKSE |||||||||||||||||||||||||||||||||||| ||| GRVFIDIVDLVKKYADEKAGKFVNGVLSAIYKAYIT....EKP -------110-------120-------130-------140---