NMR Solution Structure of Colwellia psychrerythraea protein CPS_2611. Northeast Structural Genomics target CsR4.
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.7 % (830 of 895) | 92.0 % (425 of 462) | 92.6 % (327 of 353) | 97.5 % (78 of 80) |
Backbone | 95.1 % (428 of 450) | 94.7 % (142 of 150) | 94.7 % (215 of 227) | 97.3 % (71 of 73) |
Sidechain | 91.2 % (474 of 520) | 90.7 % (283 of 312) | 91.5 % (184 of 201) | 100.0 % (7 of 7) |
Aromatic | 42.9 % (18 of 42) | 42.9 % (9 of 21) | 42.9 % (9 of 21) | |
Methyl | 100.0 % (112 of 112) | 100.0 % (56 of 56) | 100.0 % (56 of 56) |
1. protein
MPIVSKYSNE RVEKIIQDLL DVLVKEEVTP DLALMCLGNA VTNIIAQVPE SKRVAVVDNF TKALKQSVLE HHHHHHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | calcium chloride | natural abundance | 5 (±0.25) mM |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | protein | [U-5% 13C; U-100% 15N] | 1.1 (±0.1) mM | |
8 | sodium chloride | natural abundance | 100 (±5.0) mM | |
9 | calcium chloride | natural abundance | 5 (±0.25) mM | |
10 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
11 | DTT | natural abundance | 5 (±0.25) mM | |
12 | sodium azide | natural abundance | 0.02 (±0.001) % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | protein | [U-13C; U-15N] | 1.0 (±0.1) mM | |
14 | sodium chloride | natural abundance | 100 (±5.0) mM | |
15 | calcium chloride | natural abundance | 5 (±0.25) mM | |
16 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
17 | DTT | natural abundance | 5 (±0.25) mM | |
18 | sodium azide | natural abundance | 0.02 (±0.001) % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2), Details 50% NC labeled and 50% unlabeled protein mixed together to form mixed homodimer.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | protein | [U-13C; U-15N] | 0.5 (±0.05) mM | |
20 | sodium chloride | natural abundance | 100 (±5.0) mM | |
21 | calcium chloride | natural abundance | 5 (±0.25) mM | |
22 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
23 | DTT | natural abundance | 5 (±0.25) mM | |
24 | sodium azide | natural abundance | 0.02 (±0.001) % | |
25 | protein | natural abundance | 0.5 (±0.05) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | calcium chloride | natural abundance | 5 (±0.25) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | calcium chloride | natural abundance | 5 (±0.25) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | calcium chloride | natural abundance | 5 (±0.25) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | calcium chloride | natural abundance | 5 (±0.25) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | calcium chloride | natural abundance | 5 (±0.25) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | protein | [U-5% 13C; U-100% 15N] | 1.1 (±0.1) mM | |
8 | sodium chloride | natural abundance | 100 (±5.0) mM | |
9 | calcium chloride | natural abundance | 5 (±0.25) mM | |
10 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
11 | DTT | natural abundance | 5 (±0.25) mM | |
12 | sodium azide | natural abundance | 0.02 (±0.001) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | protein | [U-13C; U-15N] | 1.0 (±0.1) mM | |
14 | sodium chloride | natural abundance | 100 (±5.0) mM | |
15 | calcium chloride | natural abundance | 5 (±0.25) mM | |
16 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
17 | DTT | natural abundance | 5 (±0.25) mM | |
18 | sodium azide | natural abundance | 0.02 (±0.001) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | calcium chloride | natural abundance | 5 (±0.25) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | calcium chloride | natural abundance | 5 (±0.25) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | calcium chloride | natural abundance | 5 (±0.25) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | calcium chloride | natural abundance | 5 (±0.25) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | calcium chloride | natural abundance | 5 (±0.25) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | calcium chloride | natural abundance | 5 (±0.25) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | calcium chloride | natural abundance | 5 (±0.25) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | calcium chloride | natural abundance | 5 (±0.25) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | calcium chloride | natural abundance | 5 (±0.25) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | protein | [U-13C; U-15N] | 1.0 (±0.1) mM | |
14 | sodium chloride | natural abundance | 100 (±5.0) mM | |
15 | calcium chloride | natural abundance | 5 (±0.25) mM | |
16 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
17 | DTT | natural abundance | 5 (±0.25) mM | |
18 | sodium azide | natural abundance | 0.02 (±0.001) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | protein | [U-13C; U-15N] | 1.0 (±0.1) mM | |
14 | sodium chloride | natural abundance | 100 (±5.0) mM | |
15 | calcium chloride | natural abundance | 5 (±0.25) mM | |
16 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
17 | DTT | natural abundance | 5 (±0.25) mM | |
18 | sodium azide | natural abundance | 0.02 (±0.001) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2), Details 50% NC labeled and 50% unlabeled protein mixed together to form mixed homodimer.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | protein | [U-13C; U-15N] | 0.5 (±0.05) mM | |
20 | sodium chloride | natural abundance | 100 (±5.0) mM | |
21 | calcium chloride | natural abundance | 5 (±0.25) mM | |
22 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
23 | DTT | natural abundance | 5 (±0.25) mM | |
24 | sodium azide | natural abundance | 0.02 (±0.001) % | |
25 | protein | natural abundance | 0.5 (±0.05) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | calcium chloride | natural abundance | 5 (±0.25) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | calcium chloride | natural abundance | 5 (±0.25) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±5.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
4 | DTT | natural abundance | 5 (±0.25) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | calcium chloride | natural abundance | 5 (±0.25) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | protein | [U-13C; U-15N] | 1.0 (±0.1) mM | |
14 | sodium chloride | natural abundance | 100 (±5.0) mM | |
15 | calcium chloride | natural abundance | 5 (±0.25) mM | |
16 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
17 | DTT | natural abundance | 5 (±0.25) mM | |
18 | sodium azide | natural abundance | 0.02 (±0.001) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | protein | [U-13C; U-15N] | 1.0 (±0.1) mM | |
14 | sodium chloride | natural abundance | 100 (±5.0) mM | |
15 | calcium chloride | natural abundance | 5 (±0.25) mM | |
16 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
17 | DTT | natural abundance | 5 (±0.25) mM | |
18 | sodium azide | natural abundance | 0.02 (±0.001) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 5.5 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | protein | [U-13C; U-15N] | 1.0 (±0.1) mM | |
14 | sodium chloride | natural abundance | 100 (±5.0) mM | |
15 | calcium chloride | natural abundance | 5 (±0.25) mM | |
16 | ammonium acetate | natural abundance | 20 (±1.0) mM | |
17 | DTT | natural abundance | 5 (±0.25) mM | |
18 | sodium azide | natural abundance | 0.02 (±0.001) % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15317_2jr2.nef |
Input source #2: Coordindates | 2jr2.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70------ MPIVSKYSNERVEKIIQDLLDVLVKEEVTPDLALMCLGNAVTNIIAQVPESKRVAVVDNFTKALKQSVLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MPIVSKYSNERVEKIIQDLLDVLVKEEVTPDLALMCLGNAVTNIIAQVPESKRVAVVDNFTKALKQSVLEHHHHHH
--------10--------20--------30--------40--------50--------60--------70------ MPIVSKYSNERVEKIIQDLLDVLVKEEVTPDLALMCLGNAVTNIIAQVPESKRVAVVDNFTKALKQSVLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MPIVSKYSNERVEKIIQDLLDVLVKEEVTPDLALMCLGNAVTNIIAQVPESKRVAVVDNFTKALKQSVLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 76 | 0 | 0 | 100.0 |
B | B | 76 | 0 | 0 | 100.0 |
Content subtype: combined_15317_2jr2.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70------ MPIVSKYSNERVEKIIQDLLDVLVKEEVTPDLALMCLGNAVTNIIAQVPESKRVAVVDNFTKALKQSVLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .PIVSKYSNERVEKIIQDLLDVLVKEEVTPDLALMCLGNAVTNIIAQVPESKRVAVVDNFTKALKQSVLEHHHHH --------10--------20--------30--------40--------50--------60--------70-----
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
9 | ASN | CG | 176.3 |
39 | ASN | CG | 175.8 |
43 | ASN | CG | 175.5 |
47 | GLN | CD | 180.3 |
53 | ARG | HH21 | 6.5 |
53 | ARG | HH22 | 7.22 |
59 | ASN | CG | 176.0 |
61 | THR | HG1 | 5.11 |
66 | GLN | CD | 180.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 462 | 439 | 95.0 |
13C chemical shifts | 353 | 330 | 93.5 |
15N chemical shifts | 82 | 80 | 97.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 150 | 146 | 97.3 |
13C chemical shifts | 152 | 145 | 95.4 |
15N chemical shifts | 73 | 71 | 97.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 312 | 293 | 93.9 |
13C chemical shifts | 201 | 185 | 92.0 |
15N chemical shifts | 9 | 9 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 58 | 57 | 98.3 |
13C chemical shifts | 58 | 57 | 98.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 21 | 9 | 42.9 |
13C chemical shifts | 21 | 9 | 42.9 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70------ MPIVSKYSNERVEKIIQDLLDVLVKEEVTPDLALMCLGNAVTNIIAQVPESKRVAVVDNFTKALKQSVLEHHHHHH | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....S.YSNERVEKIIQDLLDVLVKEEVTPDLALMCLGNAVTNIIAQVPESKRVAVVDNFTKALKQSVLEH --------10--------20--------30--------40--------50--------60--------70-
--------10--------20--------30--------40--------50--------60--------70------ MPIVSKYSNERVEKIIQDLLDVLVKEEVTPDLALMCLGNAVTNIIAQVPESKRVAVVDNFTKALKQSVLEHHHHHH | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....S.YSNERVEKIIQDLLDVLVKEEVTPDLALMCLGNAVTNIIAQVPESKRVAVVDNFTKALKQSVLEH --------10--------20--------30--------40--------50--------60--------70-
--------10--------20--------30--------40--------50--------60--------70------ MPIVSKYSNERVEKIIQDLLDVLVKEEVTPDLALMCLGNAVTNIIAQVPESKRVAVVDNFTKALKQSVLEHHHHHH ||||||||||||||||| |||||||| || |||||||||||||||| ........NERVEKIIQDLLDVLVK.....DLALMCLG.AV............VAVVDNFTKALKQSVL --------10--------20--------30--------40--------50--------60---------
--------10--------20--------30--------40--------50--------60--------70------ MPIVSKYSNERVEKIIQDLLDVLVKEEVTPDLALMCLGNAVTNIIAQVPESKRVAVVDNFTKALKQSVLEHHHHHH ||||||||||||||||| |||||||| || |||||||||||||||| ........NERVEKIIQDLLDVLVK.....DLALMCLG.AV............VAVVDNFTKALKQSVL --------10--------20--------30--------40--------50--------60---------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70------ MPIVSKYSNERVEKIIQDLLDVLVKEEVTPDLALMCLGNAVTNIIAQVPESKRVAVVDNFTKALKQSVLEHHHHHH |||||||||||||||||||| |||||||||||||||||| |||||||||||||||||||||| .......SNERVEKIIQDLLDVLVKEE..PDLALMCLGNAVTNIIAQ.PESKRVAVVDNFTKALKQSVLE --------10--------20--------30--------40--------50--------60--------70
--------10--------20--------30--------40--------50--------60--------70------ MPIVSKYSNERVEKIIQDLLDVLVKEEVTPDLALMCLGNAVTNIIAQVPESKRVAVVDNFTKALKQSVLEHHHHHH |||||||||||||||||||| |||||||||||||||||| |||||||||||||||||||||| .......SNERVEKIIQDLLDVLVKEE..PDLALMCLGNAVTNIIAQ.PESKRVAVVDNFTKALKQSVLE --------10--------20--------30--------40--------50--------60--------70