C-terminal domain of ORF1p from mouse LINE-1
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.5 % (1029 of 1100) | 91.2 % (531 of 582) | 96.5 % (413 of 428) | 94.4 % (85 of 90) |
Backbone | 97.5 % (503 of 516) | 96.5 % (166 of 172) | 98.1 % (257 of 262) | 97.6 % (80 of 82) |
Sidechain | 91.3 % (612 of 670) | 89.0 % (365 of 410) | 96.0 % (242 of 252) | 62.5 % (5 of 8) |
Aromatic | 87.8 % (72 of 82) | 87.8 % (36 of 41) | 87.5 % (35 of 40) | 100.0 % (1 of 1) |
Methyl | 96.8 % (91 of 94) | 95.7 % (45 of 47) | 97.9 % (46 of 47) |
1. CTD
MQVTYKGRPI RITPDFSPET MKARRAWTDV IQTLREHKCQ PRLLYPAKLS ITIDGETKVF HDKTKFTQYL STNPALQRII TEKKQYKDSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5, Details Phosphate buffer, pH=6.5 200 mM NaCl 5.0 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | Phosphate buffer | 50 mM | ||
3 | NaCl | 200 mM | ||
4 | DTT | 5 mM | ||
5 | D2O | 7 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker DRX - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5, Details Phosphate buffer, pH=6.5 200 mM NaCl 5.0 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | Phosphate buffer | 50 mM | ||
3 | NaCl | 200 mM | ||
4 | DTT | 5 mM | ||
5 | D2O | 7 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5, Details Phosphate buffer, pH=6.5 200 mM NaCl 5.0 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | Phosphate buffer | 50 mM | ||
3 | NaCl | 200 mM | ||
4 | DTT | 5 mM | ||
5 | D2O | 7 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5, Details Phosphate buffer, pH=6.5 200 mM NaCl 5.0 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | Phosphate buffer | 50 mM | ||
3 | NaCl | 200 mM | ||
4 | DTT | 5 mM | ||
5 | D2O | 7 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5, Details Phosphate buffer, pH=6.5 200 mM NaCl 5.0 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | Phosphate buffer | 50 mM | ||
3 | NaCl | 200 mM | ||
4 | DTT | 5 mM | ||
5 | D2O | 7 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5, Details Phosphate buffer, pH=6.5 200 mM NaCl 5.0 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | Phosphate buffer | 50 mM | ||
3 | NaCl | 200 mM | ||
4 | DTT | 5 mM | ||
5 | D2O | 7 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5, Details Phosphate buffer, pH=6.5 200 mM NaCl 5.0 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | Phosphate buffer | 50 mM | ||
3 | NaCl | 200 mM | ||
4 | DTT | 5 mM | ||
5 | D2O | 7 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5, Details Phosphate buffer, pH=6.5 200 mM NaCl 5.0 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | Phosphate buffer | 50 mM | ||
3 | NaCl | 200 mM | ||
4 | DTT | 5 mM | ||
5 | D2O | 7 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5, Details Phosphate buffer, pH=6.5 200 mM NaCl 5.0 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | Phosphate buffer | 50 mM | ||
3 | NaCl | 200 mM | ||
4 | DTT | 5 mM | ||
5 | D2O | 7 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5, Details Phosphate buffer, pH=6.5 200 mM NaCl 5.0 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | Phosphate buffer | 50 mM | ||
3 | NaCl | 200 mM | ||
4 | DTT | 5 mM | ||
5 | D2O | 7 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5, Details Phosphate buffer, pH=6.5 200 mM NaCl 5.0 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | Phosphate buffer | 50 mM | ||
3 | NaCl | 200 mM | ||
4 | DTT | 5 mM | ||
5 | D2O | 7 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5, Details Phosphate buffer, pH=6.5 200 mM NaCl 5.0 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | Phosphate buffer | 50 mM | ||
3 | NaCl | 200 mM | ||
4 | DTT | 5 mM | ||
5 | D2O | 7 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5, Details Phosphate buffer, pH=6.5 200 mM NaCl 5.0 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | Phosphate buffer | 50 mM | ||
3 | NaCl | 200 mM | ||
4 | DTT | 5 mM | ||
5 | D2O | 7 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5, Details Phosphate buffer, pH=6.5 200 mM NaCl 5.0 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | Phosphate buffer | 50 mM | ||
3 | NaCl | 200 mM | ||
4 | DTT | 5 mM | ||
5 | D2O | 7 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5, Details Phosphate buffer, pH=6.5 200 mM NaCl 5.0 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | Phosphate buffer | 50 mM | ||
3 | NaCl | 200 mM | ||
4 | DTT | 5 mM | ||
5 | D2O | 7 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5, Details Phosphate buffer, pH=6.5 200 mM NaCl 5.0 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | Phosphate buffer | 50 mM | ||
3 | NaCl | 200 mM | ||
4 | DTT | 5 mM | ||
5 | D2O | 7 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 300 K, pH 6.5, Details Phosphate buffer, pH=6.5 200 mM NaCl 5.0 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | Phosphate buffer | 50 mM | ||
3 | NaCl | 200 mM | ||
4 | DTT | 5 mM | ||
5 | D2O | 7 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15325_2jrb.nef |
Input source #2: Coordindates | 2jrb.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
----280-------290-------300-------310-------320-------330-------340-------350-------360- MQVTYKGRPIRITPDFSPETMKARRAWTDVIQTLREHKCQPRLLYPAKLSITIDGETKVFHDKTKFTQYLSTNPALQRIITEKKQYKD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MQVTYKGRPIRITPDFSPETMKARRAWTDVIQTLREHKCQPRLLYPAKLSITIDGETKVFHDKTKFTQYLSTNPALQRIITEKKQYKD --------10--------20--------30--------40--------50--------60--------70--------80--------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 88 | 0 | 0 | 100.0 |
Content subtype: combined_15325_2jrb.nef
Assigned chemical shifts
----280-------290-------300-------310-------320-------330-------340-------350-------360- MQVTYKGRPIRITPDFSPETMKARRAWTDVIQTLREHKCQPRLLYPAKLSITIDGETKVFHDKTKFTQYLSTNPALQRIITEKKQYKD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MQVTYKGRPIRITPDFSPETMKARRAWTDVIQTLREHKCQPRLLYPAKLSITIDGETKVFHDKTKFTQYLSTNPALQRIITEKKQYKD
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 582 | 534 | 91.8 |
13C chemical shifts | 428 | 413 | 96.5 |
15N chemical shifts | 97 | 84 | 86.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 172 | 168 | 97.7 |
13C chemical shifts | 176 | 171 | 97.2 |
15N chemical shifts | 82 | 79 | 96.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 410 | 366 | 89.3 |
13C chemical shifts | 252 | 242 | 96.0 |
15N chemical shifts | 15 | 5 | 33.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 49 | 48 | 98.0 |
13C chemical shifts | 49 | 48 | 98.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 41 | 36 | 87.8 |
13C chemical shifts | 40 | 35 | 87.5 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
----280-------290-------300-------310-------320-------330-------340-------350-------360- MQVTYKGRPIRITPDFSPETMKARRAWTDVIQTLREHKCQPRLLYPAKLSITIDGETKVFHDKTKFTQYLSTNPALQRIITEKKQYKD ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .QVTYKGRPIRITPDFSPETMKARRAWTDVIQTLREHKCQPRLLYPAKLSITIDGETKVFHDKTKFTQYLSTNPALQRIITEKKQYKD
Dihedral angle restraints
----280-------290-------300-------310-------320-------330-------340-------350-------360- MQVTYKGRPIRITPDFSPETMKARRAWTDVIQTLREHKCQPRLLYPAKLSITIDGETKVFHDKTKFTQYLSTNPALQRIITEKKQYKD ||||| ||||||| |||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||| ||||||| MQVTY..RPIRITP.FSPETMKARRAWTDVIQTLREH.CQPRLLYPAKLSITIDGETKVFHDKTKFTQYLSTNPALQRII.EKKQYKD