Solution NMR Structure of CAPER RRM2 Domain. Northeast Structural Genomics Target HR4730A.
MGHHHHHHSH MAAAMANNLQ KGSAGPMRLY VGSLHFNITE DMLRGIFEPF GRIESIQLMM DSETGRSKGY GFITFSDSEC AKKALEQLNG FELAGRPMKV GHVTERTD
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.9 % (1117 of 1229) | 91.1 % (582 of 639) | 90.4 % (432 of 478) | 92.0 % (103 of 112) |
Backbone | 91.7 % (589 of 642) | 92.0 % (207 of 225) | 91.7 % (286 of 312) | 91.4 % (96 of 105) |
Sidechain | 90.3 % (617 of 683) | 90.6 % (375 of 414) | 89.7 % (235 of 262) | 100.0 % (7 of 7) |
Aromatic | 73.2 % (82 of 112) | 73.2 % (41 of 56) | 73.2 % (41 of 56) | |
Methyl | 100.0 % (90 of 90) | 100.0 % (45 of 45) | 100.0 % (45 of 45) |
1. HR4730A
MGHHHHHHSH MAAAMANNLQ KGSAGPMRLY VGSLHFNITE DMLRGIFEPF GRIESIQLMM DSETGRSKGY GFITFSDSEC AKKALEQLNG FELAGRPMKV GHVTERTDSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details HR4730A.003
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4730A | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | sodium azide | natural abundance | 0.02 % | |
3 | MES | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | Calcium Chloride | natural abundance | 5 mM | |
6 | DTT | natural abundance | 10 mM |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details HR4730A.012
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | HR4730A | [U-5% 13C; U-100% 15N] | 1.1 mM | |
8 | sodium azide | natural abundance | 0.02 % | |
9 | MES | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | Calcium Chloride | natural abundance | 5 mM | |
12 | DTT | natural abundance | 10 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details HR4730A.003
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4730A | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | sodium azide | natural abundance | 0.02 % | |
3 | MES | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | Calcium Chloride | natural abundance | 5 mM | |
6 | DTT | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details HR4730A.003
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4730A | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | sodium azide | natural abundance | 0.02 % | |
3 | MES | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | Calcium Chloride | natural abundance | 5 mM | |
6 | DTT | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details HR4730A.003
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4730A | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | sodium azide | natural abundance | 0.02 % | |
3 | MES | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | Calcium Chloride | natural abundance | 5 mM | |
6 | DTT | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details HR4730A.003
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4730A | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | sodium azide | natural abundance | 0.02 % | |
3 | MES | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | Calcium Chloride | natural abundance | 5 mM | |
6 | DTT | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details HR4730A.012
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | HR4730A | [U-5% 13C; U-100% 15N] | 1.1 mM | |
8 | sodium azide | natural abundance | 0.02 % | |
9 | MES | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | Calcium Chloride | natural abundance | 5 mM | |
12 | DTT | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details HR4730A.012
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | HR4730A | [U-5% 13C; U-100% 15N] | 1.1 mM | |
8 | sodium azide | natural abundance | 0.02 % | |
9 | MES | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | Calcium Chloride | natural abundance | 5 mM | |
12 | DTT | natural abundance | 10 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details HR4730A.003
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4730A | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | sodium azide | natural abundance | 0.02 % | |
3 | MES | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | Calcium Chloride | natural abundance | 5 mM | |
6 | DTT | natural abundance | 10 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details HR4730A.003
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4730A | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | sodium azide | natural abundance | 0.02 % | |
3 | MES | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | Calcium Chloride | natural abundance | 5 mM | |
6 | DTT | natural abundance | 10 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details HR4730A.003
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4730A | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | sodium azide | natural abundance | 0.02 % | |
3 | MES | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | Calcium Chloride | natural abundance | 5 mM | |
6 | DTT | natural abundance | 10 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details HR4730A.003
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4730A | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | sodium azide | natural abundance | 0.02 % | |
3 | MES | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | Calcium Chloride | natural abundance | 5 mM | |
6 | DTT | natural abundance | 10 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details HR4730A.003
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4730A | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | sodium azide | natural abundance | 0.02 % | |
3 | MES | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | Calcium Chloride | natural abundance | 5 mM | |
6 | DTT | natural abundance | 10 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details HR4730A.003
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4730A | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | sodium azide | natural abundance | 0.02 % | |
3 | MES | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | Calcium Chloride | natural abundance | 5 mM | |
6 | DTT | natural abundance | 10 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details HR4730A.003
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4730A | [U-100% 13C; U-100% 15N] | 1.3 mM | |
2 | sodium azide | natural abundance | 0.02 % | |
3 | MES | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | Calcium Chloride | natural abundance | 5 mM | |
6 | DTT | natural abundance | 10 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15343_2jrs.nef |
Input source #2: Coordindates | 2jrs.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGHHHHHHSHMAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKV -------- GHVTERTD |||||||| GHVTERTD
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 108 | 0 | 0 | 100.0 |
Content subtype: combined_15343_2jrs.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ........SHMAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKV -------- GHVTERTD |||||||| GHVTERTD
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
39 | THR | HG1 | 5.894 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 639 | 581 | 90.9 |
13C chemical shifts | 478 | 430 | 90.0 |
15N chemical shifts | 118 | 104 | 88.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 225 | 206 | 91.6 |
13C chemical shifts | 216 | 195 | 90.3 |
15N chemical shifts | 105 | 95 | 90.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 414 | 375 | 90.6 |
13C chemical shifts | 262 | 235 | 89.7 |
15N chemical shifts | 13 | 9 | 69.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 53 | 49 | 92.5 |
13C chemical shifts | 53 | 49 | 92.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 56 | 41 | 73.2 |
13C chemical shifts | 56 | 41 | 73.2 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKV ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .........HMAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------- GHVTERTD ||| GHV ---
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKV |||||||||||| ||||||||||| ||||||| |||||||||||||||||||| |||| .........................PMRLYVGSLHFN.TEDMLRGIFEP....ESIQLMM........GYGFITFSDSECAKKALEQL........PMKV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------- GHVTERTD || GH --