Northeast Structural Genomics Target SR478
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 66.8 % (655 of 981) | 65.1 % (334 of 513) | 65.7 % (249 of 379) | 80.9 % (72 of 89) |
Backbone | 75.9 % (363 of 478) | 86.9 % (139 of 160) | 63.6 % (152 of 239) | 91.1 % (72 of 79) |
Sidechain | 62.9 % (366 of 582) | 55.2 % (195 of 353) | 78.1 % (171 of 219) | 0.0 % (0 of 10) |
Aromatic | 25.0 % (22 of 88) | 25.0 % (11 of 44) | 25.0 % (11 of 44) | |
Methyl | 92.7 % (76 of 82) | 90.2 % (37 of 41) | 95.1 % (39 of 41) |
1. SR478
MSELFSVPYF IENLKQHIEM NQSEDKIHAM NSYYRSVVST LVQDQLTKNA VVLKRIQHLD EAYNKVKRGE SKLEHHHHHHPressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR478 | [U-13C; U-15N] | 0.9 mM | |
2 | Tris | natural abundance | 10 mM | |
3 | Sodium chloride | natural abundance | 100 mM | |
4 | Sodium azide | natural abundance | 0.02 % |
Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | SR478 | [U-13C; U-15N] | 0.5 mM | |
6 | SR478 | natural abundance | 0.5 mM | |
7 | Tris | natural abundance | 10 mM | |
8 | Sodium chloride | natural abundance | 100 mM | |
9 | Sodium azide | natural abundance | 0.02 % |
Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | SR478 | [U-5% 13C; U-15N] | 0.9 mM | |
11 | Tris | natural abundance | 10 mM | |
12 | Sodium chloride | natural abundance | 100 mM | |
13 | Sodium azide | natural abundance | 0.02 % |
Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
14 | SR478 | [U-5% 13C; U-15N] | 0.6 mM | |
15 | Tris | natural abundance | 10 mM | |
16 | Sodium chloride | natural abundance | 100 mM | |
17 | Sodium azide | natural abundance | 0.02 % | |
18 | Pentaethyleneglycol monodecyl ether/hexanol | natural abundance | 4 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Pressure 1 atm, Temperature 298 K, pH 6.5
Experiment name 2D 1H-15N HSQC RDC
List #1 RDC_list_1, RDC code 1DHN, Field strength (1H) 600 MHz
Varian INOVA - 600 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR478 | [U-13C; U-15N] | 0.9 mM | |
2 | Tris | natural abundance | 10 mM | |
3 | Sodium chloride | natural abundance | 100 mM | |
4 | Sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR478 | [U-13C; U-15N] | 0.9 mM | |
2 | Tris | natural abundance | 10 mM | |
3 | Sodium chloride | natural abundance | 100 mM | |
4 | Sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | SR478 | [U-13C; U-15N] | 0.5 mM | |
6 | SR478 | natural abundance | 0.5 mM | |
7 | Tris | natural abundance | 10 mM | |
8 | Sodium chloride | natural abundance | 100 mM | |
9 | Sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR478 | [U-13C; U-15N] | 0.9 mM | |
2 | Tris | natural abundance | 10 mM | |
3 | Sodium chloride | natural abundance | 100 mM | |
4 | Sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR478 | [U-13C; U-15N] | 0.9 mM | |
2 | Tris | natural abundance | 10 mM | |
3 | Sodium chloride | natural abundance | 100 mM | |
4 | Sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR478 | [U-13C; U-15N] | 0.9 mM | |
2 | Tris | natural abundance | 10 mM | |
3 | Sodium chloride | natural abundance | 100 mM | |
4 | Sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR478 | [U-13C; U-15N] | 0.9 mM | |
2 | Tris | natural abundance | 10 mM | |
3 | Sodium chloride | natural abundance | 100 mM | |
4 | Sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR478 | [U-13C; U-15N] | 0.9 mM | |
2 | Tris | natural abundance | 10 mM | |
3 | Sodium chloride | natural abundance | 100 mM | |
4 | Sodium azide | natural abundance | 0.02 % |
Varian INOVA - 800 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | SR478 | [U-5% 13C; U-15N] | 0.9 mM | |
11 | Tris | natural abundance | 10 mM | |
12 | Sodium chloride | natural abundance | 100 mM | |
13 | Sodium azide | natural abundance | 0.02 % |
Varian INOVA - 900 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR478 | [U-13C; U-15N] | 0.9 mM | |
2 | Tris | natural abundance | 10 mM | |
3 | Sodium chloride | natural abundance | 100 mM | |
4 | Sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR478 | [U-13C; U-15N] | 0.9 mM | |
2 | Tris | natural abundance | 10 mM | |
3 | Sodium chloride | natural abundance | 100 mM | |
4 | Sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR478 | [U-13C; U-15N] | 0.9 mM | |
2 | Tris | natural abundance | 10 mM | |
3 | Sodium chloride | natural abundance | 100 mM | |
4 | Sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR478 | [U-13C; U-15N] | 0.9 mM | |
2 | Tris | natural abundance | 10 mM | |
3 | Sodium chloride | natural abundance | 100 mM | |
4 | Sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR478 | [U-13C; U-15N] | 0.9 mM | |
2 | Tris | natural abundance | 10 mM | |
3 | Sodium chloride | natural abundance | 100 mM | |
4 | Sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SR478 | [U-13C; U-15N] | 0.9 mM | |
2 | Tris | natural abundance | 10 mM | |
3 | Sodium chloride | natural abundance | 100 mM | |
4 | Sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State anisotropic, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
14 | SR478 | [U-5% 13C; U-15N] | 0.6 mM | |
15 | Tris | natural abundance | 10 mM | |
16 | Sodium chloride | natural abundance | 100 mM | |
17 | Sodium azide | natural abundance | 0.02 % | |
18 | Pentaethyleneglycol monodecyl ether/hexanol | natural abundance | 4 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_15350_2js1.nef |
Input source #2: Coordindates | 2js1.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80 MSELFSVPYFIENLKQHIEMNQSEDKIHAMNSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYNKVKRGESKLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSELFSVPYFIENLKQHIEMNQSEDKIHAMNSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYNKVKRGESKLEHHHHHH
--------10--------20--------30--------40--------50--------60--------70--------80 MSELFSVPYFIENLKQHIEMNQSEDKIHAMNSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYNKVKRGESKLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSELFSVPYFIENLKQHIEMNQSEDKIHAMNSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYNKVKRGESKLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 80 | 0 | 0 | 100.0 |
B | B | 80 | 0 | 0 | 100.0 |
Content subtype: combined_15350_2js1.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80 MSELFSVPYFIENLKQHIEMNQSEDKIHAMNSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYNKVKRGESKLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSELFSVPYFIENLKQHIEMNQSEDKIHAMNSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYNKVKRGESKLEHH --------10--------20--------30--------40--------50--------60--------70------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 513 | 337 | 65.7 |
13C chemical shifts | 379 | 244 | 64.4 |
15N chemical shifts | 92 | 72 | 78.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 160 | 143 | 89.4 |
13C chemical shifts | 160 | 74 | 46.3 |
15N chemical shifts | 79 | 72 | 91.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 353 | 194 | 55.0 |
13C chemical shifts | 219 | 170 | 77.6 |
15N chemical shifts | 13 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 44 | 42 | 95.5 |
13C chemical shifts | 44 | 42 | 95.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 44 | 11 | 25.0 |
13C chemical shifts | 44 | 11 | 25.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80 MSELFSVPYFIENLKQHIEMNQSEDKIHAMNSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYNKVKRGESKLEHHHHHH ||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SEL.SVPYFIENLKQHIEMNQSEDKIHAMNSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYNKVKRGESKLEH --------10--------20--------30--------40--------50--------60--------70-----
--------10--------20--------30--------40--------50--------60--------70--------80 MSELFSVPYFIENLKQHIEMNQSEDKIHAMNSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYNKVKRGESKLEHHHHHH ||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SEL.SVPYFIENLKQHIEMNQSEDKIHAMNSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYNKVKRGESKLEH --------10--------20--------30--------40--------50--------60--------70-----
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80 MSELFSVPYFIENLKQHIEMNQSEDKIHAMNSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYNKVKRGESKLEHHHHHH ||||||||||||||| |||||||||||||||||| |||||||||||||||||||||| .....SVPYFIENLKQHIEM.....KIHAMNSYYRSVVSTLVQ....KNAVVLKRIQHLDEAYNKVKRG --------10--------20--------30--------40--------50--------60---------
--------10--------20--------30--------40--------50--------60--------70--------80 MSELFSVPYFIENLKQHIEMNQSEDKIHAMNSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYNKVKRGESKLEHHHHHH ||||||||||||||| |||||||||||||||||| |||||||||||||||||||||| .....SVPYFIENLKQHIEM.....KIHAMNSYYRSVVSTLVQ....KNAVVLKRIQHLDEAYNKVKRG --------10--------20--------30--------40--------50--------60---------
RDC restraints
--------10--------20--------30--------40--------50--------60--------70--------80 MSELFSVPYFIENLKQHIEMNQSEDKIHAMNSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYNKVKRGESKLEHHHHHH || |||||| | ||||||| || ||||||||||| |||||||||||| ||| | | ||||| .....SV.YFIENL.....M....DKIHAMN.YY.SVVSTLVQDQL.KNAVVLKRIQHL.EAY.K....E.KLEHH --------10--------20--------30--------40--------50--------60--------70------
--------10--------20--------30--------40--------50--------60--------70--------80 MSELFSVPYFIENLKQHIEMNQSEDKIHAMNSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYNKVKRGESKLEHHHHHH || |||||| | ||||||| || ||||||||||| |||||||||||| ||| | | ||||| .....SV.YFIENL.....M....DKIHAMN.YY.SVVSTLVQDQL.KNAVVLKRIQHL.EAY.K....E.KLEHH --------10--------20--------30--------40--------50--------60--------70------