Solution structure of first SH3 domain of adaptor Nck
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.3 % (704 of 771) | 88.9 % (360 of 405) | 94.5 % (277 of 293) | 91.8 % (67 of 73) |
Backbone | 94.4 % (355 of 376) | 92.1 % (117 of 127) | 95.2 % (178 of 187) | 96.8 % (60 of 62) |
Sidechain | 89.7 % (409 of 456) | 87.4 % (243 of 278) | 95.2 % (159 of 167) | 63.6 % (7 of 11) |
Aromatic | 97.2 % (70 of 72) | 100.0 % (36 of 36) | 93.9 % (31 of 33) | 100.0 % (3 of 3) |
Methyl | 100.0 % (60 of 60) | 100.0 % (30 of 30) | 100.0 % (30 of 30) |
1. Nck1-1
GSMAEEVVVV AKFDYVAQQE QELDIKKNER LWLLDDSKSW WRVRNSMNKT GFVPSNYVER KNSSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.1 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Nck1-1 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | H2O | 90 % | ||
7 | D2O | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.1 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Nck1-1 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | H2O | 90 % | ||
7 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.1 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Nck1-1 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | H2O | 90 % | ||
7 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.1 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Nck1-1 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | H2O | 90 % | ||
7 | D2O | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.1 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Nck1-1 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | H2O | 90 % | ||
7 | D2O | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.1 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Nck1-1 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | H2O | 90 % | ||
7 | D2O | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.1 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Nck1-1 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | H2O | 90 % | ||
7 | D2O | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.1 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Nck1-1 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | H2O | 90 % | ||
7 | D2O | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.1 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Nck1-1 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | H2O | 90 % | ||
7 | D2O | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.1 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Nck1-1 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | H2O | 90 % | ||
7 | D2O | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.1 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Nck1-1 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | H2O | 90 % | ||
7 | D2O | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.1 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Nck1-1 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 2 mM | |
5 | EDTA | natural abundance | 1 mM | |
6 | H2O | 90 % | ||
7 | D2O | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15351_2js2.nef |
Input source #2: Coordindates | 2js2.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--- GSMAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSMAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNS
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 63 | 0 | 0 | 100.0 |
Content subtype: combined_15351_2js2.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--- GSMAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SMAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNS
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 405 | 381 | 94.1 |
13C chemical shifts | 293 | 281 | 95.9 |
15N chemical shifts | 77 | 67 | 87.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 127 | 122 | 96.1 |
13C chemical shifts | 126 | 121 | 96.0 |
15N chemical shifts | 62 | 60 | 96.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 278 | 259 | 93.2 |
13C chemical shifts | 167 | 160 | 95.8 |
15N chemical shifts | 15 | 7 | 46.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 32 | 30 | 93.8 |
13C chemical shifts | 32 | 30 | 93.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 36 | 36 | 100.0 |
13C chemical shifts | 33 | 31 | 93.9 |
15N chemical shifts | 3 | 3 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--- GSMAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....EEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNS
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--- GSMAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNS ||||||||||||||||||||| |||||||||| ||||||||||||||||||||||| ......VVVVAKFDYVAQQEQELDIKK.ERLWLLDDSK.WWRVRNSMNKTGFVPSNYVERKN --------10--------20--------30--------40--------50--------60--