Solution structure of the E. coli Tat proofreading chaperone protein NapD
MHTNWQVCSL VVQAKSERIS DISTQLNAFP GCEVAVSDAP SGQLIVVVEA EDSETLIQTI ESVRNVEGVL AVSLVYHQQE EQGEETPRSH HHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 77.7 % (820 of 1055) | 83.9 % (453 of 540) | 67.9 % (279 of 411) | 84.6 % (88 of 104) |
Backbone | 74.3 % (419 of 564) | 87.4 % (167 of 191) | 61.6 % (173 of 281) | 85.9 % (79 of 92) |
Sidechain | 82.6 % (481 of 582) | 81.9 % (286 of 349) | 84.2 % (186 of 221) | 75.0 % (9 of 12) |
Aromatic | 48.4 % (30 of 62) | 48.4 % (15 of 31) | 46.7 % (14 of 30) | 100.0 % (1 of 1) |
Methyl | 100.0 % (118 of 118) | 100.0 % (59 of 59) | 100.0 % (59 of 59) |
1. NapD
MHTNWQVCSL VVQAKSERIS DISTQLNAFP GCEVAVSDAP SGQLIVVVEA EDSETLIQTI ESVRNVEGVL AVSLVYHQQE EQGEETPRSH HHHHHSolvent system 95% H2O/5% D2O, Temperature 298 K, pH 7.4, Details Buffer conditions were: 20 mM deuterated Tris (pH 7.4), 1 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NapD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | deuterated Tris | 20 mM | ||
3 | DTT | 1 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian INOVA - 600 MHz Triple resonance experiments
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 298 K, pH 7.4, Details Buffer conditions were: 20 mM deuterated Tris (pH 7.4), 1 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NapD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | deuterated Tris | 20 mM | ||
3 | DTT | 1 mM |
Varian INOVA - 600 MHz Triple resonance experiments
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 298 K, pH 7.4, Details Buffer conditions were: 20 mM deuterated Tris (pH 7.4), 1 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NapD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | deuterated Tris | 20 mM | ||
3 | DTT | 1 mM |
Varian INOVA - 600 MHz Triple resonance experiments
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 298 K, pH 7.4, Details Buffer conditions were: 20 mM deuterated Tris (pH 7.4), 1 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NapD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | deuterated Tris | 20 mM | ||
3 | DTT | 1 mM |
Varian INOVA - 600 MHz Triple resonance experiments
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 298 K, pH 7.4, Details Buffer conditions were: 20 mM deuterated Tris (pH 7.4), 1 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NapD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | deuterated Tris | 20 mM | ||
3 | DTT | 1 mM |
Varian INOVA - 600 MHz Triple resonance experiments
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 298 K, pH 7.4, Details Buffer conditions were: 20 mM deuterated Tris (pH 7.4), 1 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NapD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | deuterated Tris | 20 mM | ||
3 | DTT | 1 mM |
Varian INOVA - 600 MHz Triple resonance experiments
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 298 K, pH 7.4, Details Buffer conditions were: 20 mM deuterated Tris (pH 7.4), 1 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NapD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | deuterated Tris | 20 mM | ||
3 | DTT | 1 mM |
Varian INOVA - 600 MHz Triple resonance experiments
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 298 K, pH 7.4, Details Buffer conditions were: 20 mM deuterated Tris (pH 7.4), 1 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NapD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | deuterated Tris | 20 mM | ||
3 | DTT | 1 mM |
Varian INOVA - 600 MHz Triple resonance experiments
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 298 K, pH 7.4, Details Buffer conditions were: 20 mM deuterated Tris (pH 7.4), 1 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NapD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | deuterated Tris | 20 mM | ||
3 | DTT | 1 mM |
Varian INOVA - 600 MHz Triple resonance experiments
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 298 K, pH 7.4, Details Buffer conditions were: 20 mM deuterated Tris (pH 7.4), 1 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NapD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | deuterated Tris | 20 mM | ||
3 | DTT | 1 mM |
Varian INOVA - 600 MHz Triple resonance experiments
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 298 K, pH 7.4, Details Buffer conditions were: 20 mM deuterated Tris (pH 7.4), 1 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NapD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | deuterated Tris | 20 mM | ||
3 | DTT | 1 mM |
Varian INOVA - 600 MHz Triple resonance experiments
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 298 K, pH 7.4, Details Buffer conditions were: 20 mM deuterated Tris (pH 7.4), 1 mM DTT
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | NapD | [U-10% 13C; U-100% 15N] | 0.5 mM | |
8 | deuterated Tris | 20 mM | ||
9 | DTT | 1 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15381_2jsx.nef |
Input source #2: Coordindates | 2jsx.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90----- MHTNWQVCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTIESVRNVEGVLAVSLVYHQQEEQGEETPRSHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MHTNWQVCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTIESVRNVEGVLAVSLVYHQQEEQGEETPRSHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 95 | 0 | 0 | 100.0 |
Content subtype: combined_15381_2jsx.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90----- MHTNWQVCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTIESVRNVEGVLAVSLVYHQQEEQGEETPRSHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||| ..TNWQVCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTIESVRNVEGVLAVSLVYHQ..EQGEETPR --------10--------20--------30--------40--------50--------60--------70--------80--------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 540 | 443 | 82.0 |
13C chemical shifts | 411 | 266 | 64.7 |
15N chemical shifts | 107 | 85 | 79.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 191 | 164 | 85.9 |
13C chemical shifts | 190 | 83 | 43.7 |
15N chemical shifts | 92 | 77 | 83.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 349 | 279 | 79.9 |
13C chemical shifts | 221 | 183 | 82.8 |
15N chemical shifts | 15 | 8 | 53.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 60 | 59 | 98.3 |
13C chemical shifts | 60 | 59 | 98.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 31 | 15 | 48.4 |
13C chemical shifts | 30 | 14 | 46.7 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90----- MHTNWQVCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTIESVRNVEGVLAVSLVYHQQEEQGEETPRSHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||| ..TNWQVCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTIESVRNVEGVLAVSLVYHQ..EQGEETPR --------10--------20--------30--------40--------50--------60--------70--------80--------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90----- MHTNWQVCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTIESVRNVEGVLAVSLVYHQQEEQGEETPRSHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||| ||| ....WQVCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTIESVRNVEGVLAVSLV....EEQ..ETP --------10--------20--------30--------40--------50--------60--------70--------80-------