Structure of Chz1 Complexed with H2A.Z-H2B and Eviction of Nucleosomal H2A-H2B
RKETYSSYIY KVLKQTHPDT GISQKSMSIL NSFVNDIFER IATEASKLAA YNKKSTISAR EIQTAVRLIL PGELAKHAVS EGTRAVTKYS SSTQAQSSSA RAGLQFPVGR IKRYLKRHAT GRTRVGSKAA IYLTAVLEYL TAEVLELAGN AAKDLKVKRI TPRHLQLAIR GDDELDSLIR ATIASGGVLP HIAEELDKKE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 81.8 % (2435 of 2977) | 76.5 % (1184 of 1548) | 86.1 % (998 of 1159) | 93.7 % (253 of 270) |
Backbone | 95.8 % (1497 of 1562) | 94.6 % (505 of 534) | 96.4 % (743 of 771) | 96.9 % (249 of 257) |
Sidechain | 70.5 % (1171 of 1662) | 66.6 % (675 of 1014) | 77.3 % (491 of 635) | 38.5 % (5 of 13) |
Aromatic | 21.3 % (26 of 122) | 42.6 % (26 of 61) | 0.0 % (0 of 61) | |
Methyl | 88.4 % (283 of 320) | 93.1 % (149 of 160) | 83.7 % (134 of 160) |
1. H2A.Z-H2B
RKETYSSYIY KVLKQTHPDT GISQKSMSIL NSFVNDIFER IATEASKLAA YNKKSTISAR EIQTAVRLIL PGELAKHAVS EGTRAVTKYS SSTQAQSSSA RAGLQFPVGR IKRYLKRHAT GRTRVGSKAA IYLTAVLEYL TAEVLELAGN AAKDLKVKRI TPRHLQLAIR GDDELDSLIR ATIASGGVLP HIAEELDKKE2. Chz1
TVEDSESDMD DAKLDALMGN EGEEEEDDLA EIDTSNIITS GRRTRGKVID YKKTAEELDK KESolvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2A.Z-H2B | [U-35% 2H] | 1.0 ~ 1.2 mM | |
2 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
3 | MES | 25 mM | ||
4 | KCl | 200 mM | ||
5 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | H2A.Z-H2B | [U-100% 15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
7 | Chz1 | [U-30%2H] | 1.0 ~ 1.2 mM | |
8 | MES | 25 mM | ||
9 | KCl | 200 mM | ||
10 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | H2A.Z-H2B | [U-100% 13C; U-30% 2H] | 1.0 ~ 1.2 mM | |
12 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
13 | MES | 25 mM | ||
14 | KCl | 200 mM | ||
15 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | H2A.Z-H2B | [U-13C; U-15N; U-2H] | 1.0 ~ 1.2 mM | |
17 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
18 | MES | 25 mM | ||
19 | KCl | 200 mM | ||
20 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | H2A.Z-H2B | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
22 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
23 | MES | 25 mM | ||
24 | KCl | 200 mM | ||
25 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | H2A.Z-H2B | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
27 | Chz1 | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
28 | MES | 25 mM | ||
29 | KCl | 200 mM | ||
30 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
31 | H2A.Z-H2B | [U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
32 | Chz1 | [U-30% 2H] | 1.0 ~ 1.2 mM | |
33 | MES | 25 mM | ||
34 | KCl | 200 mM | ||
35 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
37 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
38 | MES | 25 mM | ||
39 | KCl | 200 mM | ||
40 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
41 | Chz1 | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
42 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
43 | MES | 25 mM | ||
44 | KCl | 200 mM | ||
45 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
46 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
47 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
48 | MES | 25 mM | ||
49 | KCl | 200 mM | ||
50 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
51 | Chz1 | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
52 | H2A.Z-H2B | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
53 | MES | 25 mM | ||
54 | KCl | 200 mM | ||
55 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
56 | H2A.Z-H2B | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
57 | Chz1 | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
58 | MES | 25 mM | ||
59 | KCl | 200 mM | ||
60 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
61 | Chz1 | [U-10% 13C; U-100% 15N] | 1.0 ~ 1.2 mM | |
62 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
63 | MES | 25 mM | ||
64 | KCl | 200 mM | ||
65 | EDTA | 1 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013292 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013292 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013292 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013292 |
#1 Model Bruker Avance (500 MHz)
#2 Model Bruker DRX (700 MHz)
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2A.Z-H2B | [U-35% 2H] | 1.0 ~ 1.2 mM | |
2 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
3 | MES | 25 mM | ||
4 | KCl | 200 mM | ||
5 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | H2A.Z-H2B | [U-100% 15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
7 | Chz1 | [U-30%2H] | 1.0 ~ 1.2 mM | |
8 | MES | 25 mM | ||
9 | KCl | 200 mM | ||
10 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | H2A.Z-H2B | [U-100% 13C; U-30% 2H] | 1.0 ~ 1.2 mM | |
12 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
13 | MES | 25 mM | ||
14 | KCl | 200 mM | ||
15 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | H2A.Z-H2B | [U-13C; U-15N; U-2H] | 1.0 ~ 1.2 mM | |
17 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
18 | MES | 25 mM | ||
19 | KCl | 200 mM | ||
20 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | H2A.Z-H2B | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
22 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
23 | MES | 25 mM | ||
24 | KCl | 200 mM | ||
25 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | H2A.Z-H2B | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
27 | Chz1 | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
28 | MES | 25 mM | ||
29 | KCl | 200 mM | ||
30 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
31 | H2A.Z-H2B | [U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
32 | Chz1 | [U-30% 2H] | 1.0 ~ 1.2 mM | |
33 | MES | 25 mM | ||
34 | KCl | 200 mM | ||
35 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
37 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
38 | MES | 25 mM | ||
39 | KCl | 200 mM | ||
40 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
41 | Chz1 | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
42 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
43 | MES | 25 mM | ||
44 | KCl | 200 mM | ||
45 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
46 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
47 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
48 | MES | 25 mM | ||
49 | KCl | 200 mM | ||
50 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
51 | Chz1 | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
52 | H2A.Z-H2B | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
53 | MES | 25 mM | ||
54 | KCl | 200 mM | ||
55 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
56 | H2A.Z-H2B | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
57 | Chz1 | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
58 | MES | 25 mM | ||
59 | KCl | 200 mM | ||
60 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
61 | Chz1 | [U-10% 13C; U-100% 15N] | 1.0 ~ 1.2 mM | |
62 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
63 | MES | 25 mM | ||
64 | KCl | 200 mM | ||
65 | EDTA | 1 mM |
#1 Model Bruker Avance (500 MHz)
#2 Model Bruker DRX (700 MHz)
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2A.Z-H2B | [U-35% 2H] | 1.0 ~ 1.2 mM | |
2 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
3 | MES | 25 mM | ||
4 | KCl | 200 mM | ||
5 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | H2A.Z-H2B | [U-100% 15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
7 | Chz1 | [U-30%2H] | 1.0 ~ 1.2 mM | |
8 | MES | 25 mM | ||
9 | KCl | 200 mM | ||
10 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | H2A.Z-H2B | [U-100% 13C; U-30% 2H] | 1.0 ~ 1.2 mM | |
12 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
13 | MES | 25 mM | ||
14 | KCl | 200 mM | ||
15 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | H2A.Z-H2B | [U-13C; U-15N; U-2H] | 1.0 ~ 1.2 mM | |
17 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
18 | MES | 25 mM | ||
19 | KCl | 200 mM | ||
20 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | H2A.Z-H2B | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
22 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
23 | MES | 25 mM | ||
24 | KCl | 200 mM | ||
25 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | H2A.Z-H2B | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
27 | Chz1 | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
28 | MES | 25 mM | ||
29 | KCl | 200 mM | ||
30 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
31 | H2A.Z-H2B | [U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
32 | Chz1 | [U-30% 2H] | 1.0 ~ 1.2 mM | |
33 | MES | 25 mM | ||
34 | KCl | 200 mM | ||
35 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
37 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
38 | MES | 25 mM | ||
39 | KCl | 200 mM | ||
40 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
41 | Chz1 | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
42 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
43 | MES | 25 mM | ||
44 | KCl | 200 mM | ||
45 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
46 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
47 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
48 | MES | 25 mM | ||
49 | KCl | 200 mM | ||
50 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
51 | Chz1 | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
52 | H2A.Z-H2B | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
53 | MES | 25 mM | ||
54 | KCl | 200 mM | ||
55 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
56 | H2A.Z-H2B | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
57 | Chz1 | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
58 | MES | 25 mM | ||
59 | KCl | 200 mM | ||
60 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
61 | Chz1 | [U-10% 13C; U-100% 15N] | 1.0 ~ 1.2 mM | |
62 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
63 | MES | 25 mM | ||
64 | KCl | 200 mM | ||
65 | EDTA | 1 mM |
#1 Model Bruker Avance (500 MHz)
#2 Model Bruker DRX (700 MHz)
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2A.Z-H2B | [U-35% 2H] | 1.0 ~ 1.2 mM | |
2 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
3 | MES | 25 mM | ||
4 | KCl | 200 mM | ||
5 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | H2A.Z-H2B | [U-100% 15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
7 | Chz1 | [U-30%2H] | 1.0 ~ 1.2 mM | |
8 | MES | 25 mM | ||
9 | KCl | 200 mM | ||
10 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | H2A.Z-H2B | [U-100% 13C; U-30% 2H] | 1.0 ~ 1.2 mM | |
12 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
13 | MES | 25 mM | ||
14 | KCl | 200 mM | ||
15 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | H2A.Z-H2B | [U-13C; U-15N; U-2H] | 1.0 ~ 1.2 mM | |
17 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
18 | MES | 25 mM | ||
19 | KCl | 200 mM | ||
20 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | H2A.Z-H2B | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
22 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
23 | MES | 25 mM | ||
24 | KCl | 200 mM | ||
25 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | H2A.Z-H2B | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
27 | Chz1 | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
28 | MES | 25 mM | ||
29 | KCl | 200 mM | ||
30 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
31 | H2A.Z-H2B | [U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
32 | Chz1 | [U-30% 2H] | 1.0 ~ 1.2 mM | |
33 | MES | 25 mM | ||
34 | KCl | 200 mM | ||
35 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
37 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
38 | MES | 25 mM | ||
39 | KCl | 200 mM | ||
40 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
41 | Chz1 | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
42 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
43 | MES | 25 mM | ||
44 | KCl | 200 mM | ||
45 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
46 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
47 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
48 | MES | 25 mM | ||
49 | KCl | 200 mM | ||
50 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
51 | Chz1 | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
52 | H2A.Z-H2B | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
53 | MES | 25 mM | ||
54 | KCl | 200 mM | ||
55 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
56 | H2A.Z-H2B | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
57 | Chz1 | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
58 | MES | 25 mM | ||
59 | KCl | 200 mM | ||
60 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
61 | Chz1 | [U-10% 13C; U-100% 15N] | 1.0 ~ 1.2 mM | |
62 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
63 | MES | 25 mM | ||
64 | KCl | 200 mM | ||
65 | EDTA | 1 mM |
#1 Model Bruker Avance (500 MHz)
#2 Model Bruker DRX (700 MHz)
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2A.Z-H2B | [U-35% 2H] | 1.0 ~ 1.2 mM | |
2 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
3 | MES | 25 mM | ||
4 | KCl | 200 mM | ||
5 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | H2A.Z-H2B | [U-100% 15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
7 | Chz1 | [U-30%2H] | 1.0 ~ 1.2 mM | |
8 | MES | 25 mM | ||
9 | KCl | 200 mM | ||
10 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | H2A.Z-H2B | [U-100% 13C; U-30% 2H] | 1.0 ~ 1.2 mM | |
12 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
13 | MES | 25 mM | ||
14 | KCl | 200 mM | ||
15 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | H2A.Z-H2B | [U-13C; U-15N; U-2H] | 1.0 ~ 1.2 mM | |
17 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
18 | MES | 25 mM | ||
19 | KCl | 200 mM | ||
20 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | H2A.Z-H2B | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
22 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
23 | MES | 25 mM | ||
24 | KCl | 200 mM | ||
25 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | H2A.Z-H2B | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
27 | Chz1 | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
28 | MES | 25 mM | ||
29 | KCl | 200 mM | ||
30 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
31 | H2A.Z-H2B | [U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
32 | Chz1 | [U-30% 2H] | 1.0 ~ 1.2 mM | |
33 | MES | 25 mM | ||
34 | KCl | 200 mM | ||
35 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
37 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
38 | MES | 25 mM | ||
39 | KCl | 200 mM | ||
40 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
41 | Chz1 | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
42 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
43 | MES | 25 mM | ||
44 | KCl | 200 mM | ||
45 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
46 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
47 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
48 | MES | 25 mM | ||
49 | KCl | 200 mM | ||
50 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
51 | Chz1 | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
52 | H2A.Z-H2B | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
53 | MES | 25 mM | ||
54 | KCl | 200 mM | ||
55 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
56 | H2A.Z-H2B | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
57 | Chz1 | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
58 | MES | 25 mM | ||
59 | KCl | 200 mM | ||
60 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
61 | Chz1 | [U-10% 13C; U-100% 15N] | 1.0 ~ 1.2 mM | |
62 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
63 | MES | 25 mM | ||
64 | KCl | 200 mM | ||
65 | EDTA | 1 mM |
#1 Model Bruker Avance (500 MHz)
#2 Model Bruker DRX (700 MHz)
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2A.Z-H2B | [U-35% 2H] | 1.0 ~ 1.2 mM | |
2 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
3 | MES | 25 mM | ||
4 | KCl | 200 mM | ||
5 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | H2A.Z-H2B | [U-100% 15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
7 | Chz1 | [U-30%2H] | 1.0 ~ 1.2 mM | |
8 | MES | 25 mM | ||
9 | KCl | 200 mM | ||
10 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | H2A.Z-H2B | [U-100% 13C; U-30% 2H] | 1.0 ~ 1.2 mM | |
12 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
13 | MES | 25 mM | ||
14 | KCl | 200 mM | ||
15 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | H2A.Z-H2B | [U-13C; U-15N; U-2H] | 1.0 ~ 1.2 mM | |
17 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
18 | MES | 25 mM | ||
19 | KCl | 200 mM | ||
20 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | H2A.Z-H2B | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
22 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
23 | MES | 25 mM | ||
24 | KCl | 200 mM | ||
25 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | H2A.Z-H2B | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
27 | Chz1 | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
28 | MES | 25 mM | ||
29 | KCl | 200 mM | ||
30 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
31 | H2A.Z-H2B | [U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
32 | Chz1 | [U-30% 2H] | 1.0 ~ 1.2 mM | |
33 | MES | 25 mM | ||
34 | KCl | 200 mM | ||
35 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
37 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
38 | MES | 25 mM | ||
39 | KCl | 200 mM | ||
40 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
41 | Chz1 | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
42 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
43 | MES | 25 mM | ||
44 | KCl | 200 mM | ||
45 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
46 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
47 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
48 | MES | 25 mM | ||
49 | KCl | 200 mM | ||
50 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
51 | Chz1 | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
52 | H2A.Z-H2B | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
53 | MES | 25 mM | ||
54 | KCl | 200 mM | ||
55 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
56 | H2A.Z-H2B | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
57 | Chz1 | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
58 | MES | 25 mM | ||
59 | KCl | 200 mM | ||
60 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
61 | Chz1 | [U-10% 13C; U-100% 15N] | 1.0 ~ 1.2 mM | |
62 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
63 | MES | 25 mM | ||
64 | KCl | 200 mM | ||
65 | EDTA | 1 mM |
#1 Model Bruker Avance (500 MHz)
#2 Model Bruker DRX (700 MHz)
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2A.Z-H2B | [U-35% 2H] | 1.0 ~ 1.2 mM | |
2 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
3 | MES | 25 mM | ||
4 | KCl | 200 mM | ||
5 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | H2A.Z-H2B | [U-100% 15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
7 | Chz1 | [U-30%2H] | 1.0 ~ 1.2 mM | |
8 | MES | 25 mM | ||
9 | KCl | 200 mM | ||
10 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | H2A.Z-H2B | [U-100% 13C; U-30% 2H] | 1.0 ~ 1.2 mM | |
12 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
13 | MES | 25 mM | ||
14 | KCl | 200 mM | ||
15 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | H2A.Z-H2B | [U-13C; U-15N; U-2H] | 1.0 ~ 1.2 mM | |
17 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
18 | MES | 25 mM | ||
19 | KCl | 200 mM | ||
20 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | H2A.Z-H2B | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
22 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
23 | MES | 25 mM | ||
24 | KCl | 200 mM | ||
25 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | H2A.Z-H2B | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
27 | Chz1 | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
28 | MES | 25 mM | ||
29 | KCl | 200 mM | ||
30 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
31 | H2A.Z-H2B | [U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
32 | Chz1 | [U-30% 2H] | 1.0 ~ 1.2 mM | |
33 | MES | 25 mM | ||
34 | KCl | 200 mM | ||
35 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
37 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
38 | MES | 25 mM | ||
39 | KCl | 200 mM | ||
40 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
41 | Chz1 | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
42 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
43 | MES | 25 mM | ||
44 | KCl | 200 mM | ||
45 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
46 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
47 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
48 | MES | 25 mM | ||
49 | KCl | 200 mM | ||
50 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
51 | Chz1 | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
52 | H2A.Z-H2B | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
53 | MES | 25 mM | ||
54 | KCl | 200 mM | ||
55 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
56 | H2A.Z-H2B | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
57 | Chz1 | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
58 | MES | 25 mM | ||
59 | KCl | 200 mM | ||
60 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
61 | Chz1 | [U-10% 13C; U-100% 15N] | 1.0 ~ 1.2 mM | |
62 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
63 | MES | 25 mM | ||
64 | KCl | 200 mM | ||
65 | EDTA | 1 mM |
#1 Model Bruker Avance (500 MHz)
#2 Model Bruker DRX (700 MHz)
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2A.Z-H2B | [U-35% 2H] | 1.0 ~ 1.2 mM | |
2 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
3 | MES | 25 mM | ||
4 | KCl | 200 mM | ||
5 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | H2A.Z-H2B | [U-100% 15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
7 | Chz1 | [U-30%2H] | 1.0 ~ 1.2 mM | |
8 | MES | 25 mM | ||
9 | KCl | 200 mM | ||
10 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | H2A.Z-H2B | [U-100% 13C; U-30% 2H] | 1.0 ~ 1.2 mM | |
12 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
13 | MES | 25 mM | ||
14 | KCl | 200 mM | ||
15 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | H2A.Z-H2B | [U-13C; U-15N; U-2H] | 1.0 ~ 1.2 mM | |
17 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
18 | MES | 25 mM | ||
19 | KCl | 200 mM | ||
20 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | H2A.Z-H2B | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
22 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
23 | MES | 25 mM | ||
24 | KCl | 200 mM | ||
25 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | H2A.Z-H2B | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
27 | Chz1 | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
28 | MES | 25 mM | ||
29 | KCl | 200 mM | ||
30 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
31 | H2A.Z-H2B | [U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
32 | Chz1 | [U-30% 2H] | 1.0 ~ 1.2 mM | |
33 | MES | 25 mM | ||
34 | KCl | 200 mM | ||
35 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
37 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
38 | MES | 25 mM | ||
39 | KCl | 200 mM | ||
40 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
41 | Chz1 | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
42 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
43 | MES | 25 mM | ||
44 | KCl | 200 mM | ||
45 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
46 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
47 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
48 | MES | 25 mM | ||
49 | KCl | 200 mM | ||
50 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
51 | Chz1 | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
52 | H2A.Z-H2B | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
53 | MES | 25 mM | ||
54 | KCl | 200 mM | ||
55 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
56 | H2A.Z-H2B | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
57 | Chz1 | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
58 | MES | 25 mM | ||
59 | KCl | 200 mM | ||
60 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
61 | Chz1 | [U-10% 13C; U-100% 15N] | 1.0 ~ 1.2 mM | |
62 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
63 | MES | 25 mM | ||
64 | KCl | 200 mM | ||
65 | EDTA | 1 mM |
#1 Model Bruker Avance (500 MHz)
#2 Model Bruker DRX (700 MHz)
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2A.Z-H2B | [U-35% 2H] | 1.0 ~ 1.2 mM | |
2 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
3 | MES | 25 mM | ||
4 | KCl | 200 mM | ||
5 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | H2A.Z-H2B | [U-100% 15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
7 | Chz1 | [U-30%2H] | 1.0 ~ 1.2 mM | |
8 | MES | 25 mM | ||
9 | KCl | 200 mM | ||
10 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | H2A.Z-H2B | [U-100% 13C; U-30% 2H] | 1.0 ~ 1.2 mM | |
12 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
13 | MES | 25 mM | ||
14 | KCl | 200 mM | ||
15 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | H2A.Z-H2B | [U-13C; U-15N; U-2H] | 1.0 ~ 1.2 mM | |
17 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
18 | MES | 25 mM | ||
19 | KCl | 200 mM | ||
20 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | H2A.Z-H2B | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
22 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
23 | MES | 25 mM | ||
24 | KCl | 200 mM | ||
25 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | H2A.Z-H2B | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
27 | Chz1 | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
28 | MES | 25 mM | ||
29 | KCl | 200 mM | ||
30 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
31 | H2A.Z-H2B | [U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
32 | Chz1 | [U-30% 2H] | 1.0 ~ 1.2 mM | |
33 | MES | 25 mM | ||
34 | KCl | 200 mM | ||
35 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
37 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
38 | MES | 25 mM | ||
39 | KCl | 200 mM | ||
40 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
41 | Chz1 | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
42 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
43 | MES | 25 mM | ||
44 | KCl | 200 mM | ||
45 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
46 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
47 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
48 | MES | 25 mM | ||
49 | KCl | 200 mM | ||
50 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
51 | Chz1 | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
52 | H2A.Z-H2B | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
53 | MES | 25 mM | ||
54 | KCl | 200 mM | ||
55 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
56 | H2A.Z-H2B | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
57 | Chz1 | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
58 | MES | 25 mM | ||
59 | KCl | 200 mM | ||
60 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
61 | Chz1 | [U-10% 13C; U-100% 15N] | 1.0 ~ 1.2 mM | |
62 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
63 | MES | 25 mM | ||
64 | KCl | 200 mM | ||
65 | EDTA | 1 mM |
#1 Model Bruker Avance (500 MHz)
#2 Model Bruker DRX (700 MHz)
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2A.Z-H2B | [U-35% 2H] | 1.0 ~ 1.2 mM | |
2 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
3 | MES | 25 mM | ||
4 | KCl | 200 mM | ||
5 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | H2A.Z-H2B | [U-100% 15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
7 | Chz1 | [U-30%2H] | 1.0 ~ 1.2 mM | |
8 | MES | 25 mM | ||
9 | KCl | 200 mM | ||
10 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | H2A.Z-H2B | [U-100% 13C; U-30% 2H] | 1.0 ~ 1.2 mM | |
12 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
13 | MES | 25 mM | ||
14 | KCl | 200 mM | ||
15 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | H2A.Z-H2B | [U-13C; U-15N; U-2H] | 1.0 ~ 1.2 mM | |
17 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
18 | MES | 25 mM | ||
19 | KCl | 200 mM | ||
20 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | H2A.Z-H2B | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
22 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
23 | MES | 25 mM | ||
24 | KCl | 200 mM | ||
25 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | H2A.Z-H2B | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
27 | Chz1 | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
28 | MES | 25 mM | ||
29 | KCl | 200 mM | ||
30 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
31 | H2A.Z-H2B | [U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
32 | Chz1 | [U-30% 2H] | 1.0 ~ 1.2 mM | |
33 | MES | 25 mM | ||
34 | KCl | 200 mM | ||
35 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
37 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
38 | MES | 25 mM | ||
39 | KCl | 200 mM | ||
40 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
41 | Chz1 | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
42 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
43 | MES | 25 mM | ||
44 | KCl | 200 mM | ||
45 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
46 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
47 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
48 | MES | 25 mM | ||
49 | KCl | 200 mM | ||
50 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
51 | Chz1 | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
52 | H2A.Z-H2B | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
53 | MES | 25 mM | ||
54 | KCl | 200 mM | ||
55 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
56 | H2A.Z-H2B | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
57 | Chz1 | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
58 | MES | 25 mM | ||
59 | KCl | 200 mM | ||
60 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
61 | Chz1 | [U-10% 13C; U-100% 15N] | 1.0 ~ 1.2 mM | |
62 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
63 | MES | 25 mM | ||
64 | KCl | 200 mM | ||
65 | EDTA | 1 mM |
#1 Model Bruker Avance (500 MHz)
#2 Model Bruker DRX (700 MHz)
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2A.Z-H2B | [U-35% 2H] | 1.0 ~ 1.2 mM | |
2 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
3 | MES | 25 mM | ||
4 | KCl | 200 mM | ||
5 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | H2A.Z-H2B | [U-100% 15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
7 | Chz1 | [U-30%2H] | 1.0 ~ 1.2 mM | |
8 | MES | 25 mM | ||
9 | KCl | 200 mM | ||
10 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | H2A.Z-H2B | [U-100% 13C; U-30% 2H] | 1.0 ~ 1.2 mM | |
12 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
13 | MES | 25 mM | ||
14 | KCl | 200 mM | ||
15 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | H2A.Z-H2B | [U-13C; U-15N; U-2H] | 1.0 ~ 1.2 mM | |
17 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
18 | MES | 25 mM | ||
19 | KCl | 200 mM | ||
20 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | H2A.Z-H2B | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
22 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
23 | MES | 25 mM | ||
24 | KCl | 200 mM | ||
25 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | H2A.Z-H2B | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
27 | Chz1 | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
28 | MES | 25 mM | ||
29 | KCl | 200 mM | ||
30 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
31 | H2A.Z-H2B | [U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
32 | Chz1 | [U-30% 2H] | 1.0 ~ 1.2 mM | |
33 | MES | 25 mM | ||
34 | KCl | 200 mM | ||
35 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
37 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
38 | MES | 25 mM | ||
39 | KCl | 200 mM | ||
40 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
41 | Chz1 | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
42 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
43 | MES | 25 mM | ||
44 | KCl | 200 mM | ||
45 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
46 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
47 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
48 | MES | 25 mM | ||
49 | KCl | 200 mM | ||
50 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
51 | Chz1 | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
52 | H2A.Z-H2B | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
53 | MES | 25 mM | ||
54 | KCl | 200 mM | ||
55 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
56 | H2A.Z-H2B | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
57 | Chz1 | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
58 | MES | 25 mM | ||
59 | KCl | 200 mM | ||
60 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
61 | Chz1 | [U-10% 13C; U-100% 15N] | 1.0 ~ 1.2 mM | |
62 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
63 | MES | 25 mM | ||
64 | KCl | 200 mM | ||
65 | EDTA | 1 mM |
#1 Model Bruker Avance (500 MHz)
#2 Model Bruker DRX (700 MHz)
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2A.Z-H2B | [U-35% 2H] | 1.0 ~ 1.2 mM | |
2 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
3 | MES | 25 mM | ||
4 | KCl | 200 mM | ||
5 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | H2A.Z-H2B | [U-100% 15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
7 | Chz1 | [U-30%2H] | 1.0 ~ 1.2 mM | |
8 | MES | 25 mM | ||
9 | KCl | 200 mM | ||
10 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | H2A.Z-H2B | [U-100% 13C; U-30% 2H] | 1.0 ~ 1.2 mM | |
12 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
13 | MES | 25 mM | ||
14 | KCl | 200 mM | ||
15 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | H2A.Z-H2B | [U-13C; U-15N; U-2H] | 1.0 ~ 1.2 mM | |
17 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
18 | MES | 25 mM | ||
19 | KCl | 200 mM | ||
20 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | H2A.Z-H2B | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
22 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
23 | MES | 25 mM | ||
24 | KCl | 200 mM | ||
25 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | H2A.Z-H2B | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
27 | Chz1 | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
28 | MES | 25 mM | ||
29 | KCl | 200 mM | ||
30 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
31 | H2A.Z-H2B | [U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
32 | Chz1 | [U-30% 2H] | 1.0 ~ 1.2 mM | |
33 | MES | 25 mM | ||
34 | KCl | 200 mM | ||
35 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
37 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
38 | MES | 25 mM | ||
39 | KCl | 200 mM | ||
40 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
41 | Chz1 | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
42 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
43 | MES | 25 mM | ||
44 | KCl | 200 mM | ||
45 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
46 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
47 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
48 | MES | 25 mM | ||
49 | KCl | 200 mM | ||
50 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
51 | Chz1 | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
52 | H2A.Z-H2B | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
53 | MES | 25 mM | ||
54 | KCl | 200 mM | ||
55 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
56 | H2A.Z-H2B | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
57 | Chz1 | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
58 | MES | 25 mM | ||
59 | KCl | 200 mM | ||
60 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
61 | Chz1 | [U-10% 13C; U-100% 15N] | 1.0 ~ 1.2 mM | |
62 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
63 | MES | 25 mM | ||
64 | KCl | 200 mM | ||
65 | EDTA | 1 mM |
#1 Model Bruker Avance (500 MHz)
#2 Model Bruker DRX (700 MHz)
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2A.Z-H2B | [U-35% 2H] | 1.0 ~ 1.2 mM | |
2 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
3 | MES | 25 mM | ||
4 | KCl | 200 mM | ||
5 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | H2A.Z-H2B | [U-100% 15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
7 | Chz1 | [U-30%2H] | 1.0 ~ 1.2 mM | |
8 | MES | 25 mM | ||
9 | KCl | 200 mM | ||
10 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | H2A.Z-H2B | [U-100% 13C; U-30% 2H] | 1.0 ~ 1.2 mM | |
12 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
13 | MES | 25 mM | ||
14 | KCl | 200 mM | ||
15 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | H2A.Z-H2B | [U-13C; U-15N; U-2H] | 1.0 ~ 1.2 mM | |
17 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
18 | MES | 25 mM | ||
19 | KCl | 200 mM | ||
20 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | H2A.Z-H2B | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
22 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
23 | MES | 25 mM | ||
24 | KCl | 200 mM | ||
25 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | H2A.Z-H2B | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
27 | Chz1 | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
28 | MES | 25 mM | ||
29 | KCl | 200 mM | ||
30 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
31 | H2A.Z-H2B | [U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
32 | Chz1 | [U-30% 2H] | 1.0 ~ 1.2 mM | |
33 | MES | 25 mM | ||
34 | KCl | 200 mM | ||
35 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
37 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
38 | MES | 25 mM | ||
39 | KCl | 200 mM | ||
40 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
41 | Chz1 | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
42 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
43 | MES | 25 mM | ||
44 | KCl | 200 mM | ||
45 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
46 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
47 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
48 | MES | 25 mM | ||
49 | KCl | 200 mM | ||
50 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
51 | Chz1 | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
52 | H2A.Z-H2B | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
53 | MES | 25 mM | ||
54 | KCl | 200 mM | ||
55 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
56 | H2A.Z-H2B | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
57 | Chz1 | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
58 | MES | 25 mM | ||
59 | KCl | 200 mM | ||
60 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
61 | Chz1 | [U-10% 13C; U-100% 15N] | 1.0 ~ 1.2 mM | |
62 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
63 | MES | 25 mM | ||
64 | KCl | 200 mM | ||
65 | EDTA | 1 mM |
#1 Model Bruker Avance (500 MHz)
#2 Model Bruker DRX (700 MHz)
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2A.Z-H2B | [U-35% 2H] | 1.0 ~ 1.2 mM | |
2 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
3 | MES | 25 mM | ||
4 | KCl | 200 mM | ||
5 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | H2A.Z-H2B | [U-100% 15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
7 | Chz1 | [U-30%2H] | 1.0 ~ 1.2 mM | |
8 | MES | 25 mM | ||
9 | KCl | 200 mM | ||
10 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | H2A.Z-H2B | [U-100% 13C; U-30% 2H] | 1.0 ~ 1.2 mM | |
12 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
13 | MES | 25 mM | ||
14 | KCl | 200 mM | ||
15 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | H2A.Z-H2B | [U-13C; U-15N; U-2H] | 1.0 ~ 1.2 mM | |
17 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
18 | MES | 25 mM | ||
19 | KCl | 200 mM | ||
20 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | H2A.Z-H2B | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
22 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
23 | MES | 25 mM | ||
24 | KCl | 200 mM | ||
25 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | H2A.Z-H2B | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
27 | Chz1 | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
28 | MES | 25 mM | ||
29 | KCl | 200 mM | ||
30 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
31 | H2A.Z-H2B | [U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
32 | Chz1 | [U-30% 2H] | 1.0 ~ 1.2 mM | |
33 | MES | 25 mM | ||
34 | KCl | 200 mM | ||
35 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
37 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
38 | MES | 25 mM | ||
39 | KCl | 200 mM | ||
40 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
41 | Chz1 | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
42 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
43 | MES | 25 mM | ||
44 | KCl | 200 mM | ||
45 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
46 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
47 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
48 | MES | 25 mM | ||
49 | KCl | 200 mM | ||
50 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
51 | Chz1 | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
52 | H2A.Z-H2B | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
53 | MES | 25 mM | ||
54 | KCl | 200 mM | ||
55 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
56 | H2A.Z-H2B | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
57 | Chz1 | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
58 | MES | 25 mM | ||
59 | KCl | 200 mM | ||
60 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
61 | Chz1 | [U-10% 13C; U-100% 15N] | 1.0 ~ 1.2 mM | |
62 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
63 | MES | 25 mM | ||
64 | KCl | 200 mM | ||
65 | EDTA | 1 mM |
#1 Model Bruker Avance (500 MHz)
#2 Model Bruker DRX (700 MHz)
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2A.Z-H2B | [U-35% 2H] | 1.0 ~ 1.2 mM | |
2 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
3 | MES | 25 mM | ||
4 | KCl | 200 mM | ||
5 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | H2A.Z-H2B | [U-100% 15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
7 | Chz1 | [U-30%2H] | 1.0 ~ 1.2 mM | |
8 | MES | 25 mM | ||
9 | KCl | 200 mM | ||
10 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | H2A.Z-H2B | [U-100% 13C; U-30% 2H] | 1.0 ~ 1.2 mM | |
12 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
13 | MES | 25 mM | ||
14 | KCl | 200 mM | ||
15 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | H2A.Z-H2B | [U-13C; U-15N; U-2H] | 1.0 ~ 1.2 mM | |
17 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
18 | MES | 25 mM | ||
19 | KCl | 200 mM | ||
20 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | H2A.Z-H2B | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
22 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
23 | MES | 25 mM | ||
24 | KCl | 200 mM | ||
25 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | H2A.Z-H2B | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
27 | Chz1 | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
28 | MES | 25 mM | ||
29 | KCl | 200 mM | ||
30 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
31 | H2A.Z-H2B | [U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
32 | Chz1 | [U-30% 2H] | 1.0 ~ 1.2 mM | |
33 | MES | 25 mM | ||
34 | KCl | 200 mM | ||
35 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
37 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
38 | MES | 25 mM | ||
39 | KCl | 200 mM | ||
40 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
41 | Chz1 | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
42 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
43 | MES | 25 mM | ||
44 | KCl | 200 mM | ||
45 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
46 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
47 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
48 | MES | 25 mM | ||
49 | KCl | 200 mM | ||
50 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
51 | Chz1 | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
52 | H2A.Z-H2B | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
53 | MES | 25 mM | ||
54 | KCl | 200 mM | ||
55 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
56 | H2A.Z-H2B | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
57 | Chz1 | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
58 | MES | 25 mM | ||
59 | KCl | 200 mM | ||
60 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
61 | Chz1 | [U-10% 13C; U-100% 15N] | 1.0 ~ 1.2 mM | |
62 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
63 | MES | 25 mM | ||
64 | KCl | 200 mM | ||
65 | EDTA | 1 mM |
#1 Model Bruker Avance (500 MHz)
#2 Model Bruker DRX (700 MHz)
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2A.Z-H2B | [U-35% 2H] | 1.0 ~ 1.2 mM | |
2 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
3 | MES | 25 mM | ||
4 | KCl | 200 mM | ||
5 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | H2A.Z-H2B | [U-100% 15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
7 | Chz1 | [U-30%2H] | 1.0 ~ 1.2 mM | |
8 | MES | 25 mM | ||
9 | KCl | 200 mM | ||
10 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | H2A.Z-H2B | [U-100% 13C; U-30% 2H] | 1.0 ~ 1.2 mM | |
12 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
13 | MES | 25 mM | ||
14 | KCl | 200 mM | ||
15 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | H2A.Z-H2B | [U-13C; U-15N; U-2H] | 1.0 ~ 1.2 mM | |
17 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
18 | MES | 25 mM | ||
19 | KCl | 200 mM | ||
20 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | H2A.Z-H2B | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
22 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
23 | MES | 25 mM | ||
24 | KCl | 200 mM | ||
25 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | H2A.Z-H2B | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
27 | Chz1 | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
28 | MES | 25 mM | ||
29 | KCl | 200 mM | ||
30 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
31 | H2A.Z-H2B | [U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
32 | Chz1 | [U-30% 2H] | 1.0 ~ 1.2 mM | |
33 | MES | 25 mM | ||
34 | KCl | 200 mM | ||
35 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
37 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
38 | MES | 25 mM | ||
39 | KCl | 200 mM | ||
40 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
41 | Chz1 | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
42 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
43 | MES | 25 mM | ||
44 | KCl | 200 mM | ||
45 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
46 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
47 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
48 | MES | 25 mM | ||
49 | KCl | 200 mM | ||
50 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
51 | Chz1 | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
52 | H2A.Z-H2B | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
53 | MES | 25 mM | ||
54 | KCl | 200 mM | ||
55 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
56 | H2A.Z-H2B | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
57 | Chz1 | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
58 | MES | 25 mM | ||
59 | KCl | 200 mM | ||
60 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
61 | Chz1 | [U-10% 13C; U-100% 15N] | 1.0 ~ 1.2 mM | |
62 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
63 | MES | 25 mM | ||
64 | KCl | 200 mM | ||
65 | EDTA | 1 mM |
#1 Model Bruker Avance (500 MHz)
#2 Model Bruker DRX (700 MHz)
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2A.Z-H2B | [U-35% 2H] | 1.0 ~ 1.2 mM | |
2 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
3 | MES | 25 mM | ||
4 | KCl | 200 mM | ||
5 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | H2A.Z-H2B | [U-100% 15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
7 | Chz1 | [U-30%2H] | 1.0 ~ 1.2 mM | |
8 | MES | 25 mM | ||
9 | KCl | 200 mM | ||
10 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | H2A.Z-H2B | [U-100% 13C; U-30% 2H] | 1.0 ~ 1.2 mM | |
12 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
13 | MES | 25 mM | ||
14 | KCl | 200 mM | ||
15 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | H2A.Z-H2B | [U-13C; U-15N; U-2H] | 1.0 ~ 1.2 mM | |
17 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
18 | MES | 25 mM | ||
19 | KCl | 200 mM | ||
20 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | H2A.Z-H2B | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
22 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
23 | MES | 25 mM | ||
24 | KCl | 200 mM | ||
25 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | H2A.Z-H2B | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
27 | Chz1 | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
28 | MES | 25 mM | ||
29 | KCl | 200 mM | ||
30 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
31 | H2A.Z-H2B | [U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
32 | Chz1 | [U-30% 2H] | 1.0 ~ 1.2 mM | |
33 | MES | 25 mM | ||
34 | KCl | 200 mM | ||
35 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
37 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
38 | MES | 25 mM | ||
39 | KCl | 200 mM | ||
40 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
41 | Chz1 | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
42 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
43 | MES | 25 mM | ||
44 | KCl | 200 mM | ||
45 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
46 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
47 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
48 | MES | 25 mM | ||
49 | KCl | 200 mM | ||
50 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
51 | Chz1 | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
52 | H2A.Z-H2B | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
53 | MES | 25 mM | ||
54 | KCl | 200 mM | ||
55 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
56 | H2A.Z-H2B | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
57 | Chz1 | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
58 | MES | 25 mM | ||
59 | KCl | 200 mM | ||
60 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
61 | Chz1 | [U-10% 13C; U-100% 15N] | 1.0 ~ 1.2 mM | |
62 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
63 | MES | 25 mM | ||
64 | KCl | 200 mM | ||
65 | EDTA | 1 mM |
#1 Model Bruker Avance (500 MHz)
#2 Model Bruker DRX (700 MHz)
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2A.Z-H2B | [U-35% 2H] | 1.0 ~ 1.2 mM | |
2 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
3 | MES | 25 mM | ||
4 | KCl | 200 mM | ||
5 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | H2A.Z-H2B | [U-100% 15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
7 | Chz1 | [U-30%2H] | 1.0 ~ 1.2 mM | |
8 | MES | 25 mM | ||
9 | KCl | 200 mM | ||
10 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | H2A.Z-H2B | [U-100% 13C; U-30% 2H] | 1.0 ~ 1.2 mM | |
12 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
13 | MES | 25 mM | ||
14 | KCl | 200 mM | ||
15 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | H2A.Z-H2B | [U-13C; U-15N; U-2H] | 1.0 ~ 1.2 mM | |
17 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
18 | MES | 25 mM | ||
19 | KCl | 200 mM | ||
20 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | H2A.Z-H2B | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
22 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
23 | MES | 25 mM | ||
24 | KCl | 200 mM | ||
25 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | H2A.Z-H2B | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
27 | Chz1 | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
28 | MES | 25 mM | ||
29 | KCl | 200 mM | ||
30 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
31 | H2A.Z-H2B | [U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
32 | Chz1 | [U-30% 2H] | 1.0 ~ 1.2 mM | |
33 | MES | 25 mM | ||
34 | KCl | 200 mM | ||
35 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
37 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
38 | MES | 25 mM | ||
39 | KCl | 200 mM | ||
40 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
41 | Chz1 | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
42 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
43 | MES | 25 mM | ||
44 | KCl | 200 mM | ||
45 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
46 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
47 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
48 | MES | 25 mM | ||
49 | KCl | 200 mM | ||
50 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
51 | Chz1 | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
52 | H2A.Z-H2B | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
53 | MES | 25 mM | ||
54 | KCl | 200 mM | ||
55 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
56 | H2A.Z-H2B | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
57 | Chz1 | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
58 | MES | 25 mM | ||
59 | KCl | 200 mM | ||
60 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
61 | Chz1 | [U-10% 13C; U-100% 15N] | 1.0 ~ 1.2 mM | |
62 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
63 | MES | 25 mM | ||
64 | KCl | 200 mM | ||
65 | EDTA | 1 mM |
#1 Model Bruker Avance (500 MHz)
#2 Model Bruker DRX (700 MHz)
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2A.Z-H2B | [U-35% 2H] | 1.0 ~ 1.2 mM | |
2 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
3 | MES | 25 mM | ||
4 | KCl | 200 mM | ||
5 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | H2A.Z-H2B | [U-100% 15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
7 | Chz1 | [U-30%2H] | 1.0 ~ 1.2 mM | |
8 | MES | 25 mM | ||
9 | KCl | 200 mM | ||
10 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | H2A.Z-H2B | [U-100% 13C; U-30% 2H] | 1.0 ~ 1.2 mM | |
12 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
13 | MES | 25 mM | ||
14 | KCl | 200 mM | ||
15 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | H2A.Z-H2B | [U-13C; U-15N; U-2H] | 1.0 ~ 1.2 mM | |
17 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
18 | MES | 25 mM | ||
19 | KCl | 200 mM | ||
20 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | H2A.Z-H2B | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
22 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
23 | MES | 25 mM | ||
24 | KCl | 200 mM | ||
25 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | H2A.Z-H2B | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
27 | Chz1 | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
28 | MES | 25 mM | ||
29 | KCl | 200 mM | ||
30 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
31 | H2A.Z-H2B | [U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
32 | Chz1 | [U-30% 2H] | 1.0 ~ 1.2 mM | |
33 | MES | 25 mM | ||
34 | KCl | 200 mM | ||
35 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
37 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
38 | MES | 25 mM | ||
39 | KCl | 200 mM | ||
40 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
41 | Chz1 | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
42 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
43 | MES | 25 mM | ||
44 | KCl | 200 mM | ||
45 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
46 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
47 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
48 | MES | 25 mM | ||
49 | KCl | 200 mM | ||
50 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
51 | Chz1 | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
52 | H2A.Z-H2B | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
53 | MES | 25 mM | ||
54 | KCl | 200 mM | ||
55 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
56 | H2A.Z-H2B | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
57 | Chz1 | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
58 | MES | 25 mM | ||
59 | KCl | 200 mM | ||
60 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
61 | Chz1 | [U-10% 13C; U-100% 15N] | 1.0 ~ 1.2 mM | |
62 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
63 | MES | 25 mM | ||
64 | KCl | 200 mM | ||
65 | EDTA | 1 mM |
#1 Model Bruker Avance (500 MHz)
#2 Model Bruker DRX (700 MHz)
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2A.Z-H2B | [U-35% 2H] | 1.0 ~ 1.2 mM | |
2 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
3 | MES | 25 mM | ||
4 | KCl | 200 mM | ||
5 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | H2A.Z-H2B | [U-100% 15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
7 | Chz1 | [U-30%2H] | 1.0 ~ 1.2 mM | |
8 | MES | 25 mM | ||
9 | KCl | 200 mM | ||
10 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | H2A.Z-H2B | [U-100% 13C; U-30% 2H] | 1.0 ~ 1.2 mM | |
12 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
13 | MES | 25 mM | ||
14 | KCl | 200 mM | ||
15 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | H2A.Z-H2B | [U-13C; U-15N; U-2H] | 1.0 ~ 1.2 mM | |
17 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
18 | MES | 25 mM | ||
19 | KCl | 200 mM | ||
20 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | H2A.Z-H2B | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
22 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
23 | MES | 25 mM | ||
24 | KCl | 200 mM | ||
25 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | H2A.Z-H2B | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
27 | Chz1 | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
28 | MES | 25 mM | ||
29 | KCl | 200 mM | ||
30 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
31 | H2A.Z-H2B | [U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
32 | Chz1 | [U-30% 2H] | 1.0 ~ 1.2 mM | |
33 | MES | 25 mM | ||
34 | KCl | 200 mM | ||
35 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
37 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
38 | MES | 25 mM | ||
39 | KCl | 200 mM | ||
40 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
41 | Chz1 | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
42 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
43 | MES | 25 mM | ||
44 | KCl | 200 mM | ||
45 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
46 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
47 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
48 | MES | 25 mM | ||
49 | KCl | 200 mM | ||
50 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
51 | Chz1 | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
52 | H2A.Z-H2B | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
53 | MES | 25 mM | ||
54 | KCl | 200 mM | ||
55 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
56 | H2A.Z-H2B | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
57 | Chz1 | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
58 | MES | 25 mM | ||
59 | KCl | 200 mM | ||
60 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
61 | Chz1 | [U-10% 13C; U-100% 15N] | 1.0 ~ 1.2 mM | |
62 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
63 | MES | 25 mM | ||
64 | KCl | 200 mM | ||
65 | EDTA | 1 mM |
#1 Model Bruker Avance (500 MHz)
#2 Model Bruker DRX (700 MHz)
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2A.Z-H2B | [U-35% 2H] | 1.0 ~ 1.2 mM | |
2 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
3 | MES | 25 mM | ||
4 | KCl | 200 mM | ||
5 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | H2A.Z-H2B | [U-100% 15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
7 | Chz1 | [U-30%2H] | 1.0 ~ 1.2 mM | |
8 | MES | 25 mM | ||
9 | KCl | 200 mM | ||
10 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | H2A.Z-H2B | [U-100% 13C; U-30% 2H] | 1.0 ~ 1.2 mM | |
12 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
13 | MES | 25 mM | ||
14 | KCl | 200 mM | ||
15 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | H2A.Z-H2B | [U-13C; U-15N; U-2H] | 1.0 ~ 1.2 mM | |
17 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
18 | MES | 25 mM | ||
19 | KCl | 200 mM | ||
20 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | H2A.Z-H2B | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
22 | Chz1 | [U-100% 2H] | 1.0 ~ 1.2 mM | |
23 | MES | 25 mM | ||
24 | KCl | 200 mM | ||
25 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | H2A.Z-H2B | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
27 | Chz1 | [U-100% 13C;U-35%2H]/[U-100% 2H] | 1.0 ~ 1.2 mM | |
28 | MES | 25 mM | ||
29 | KCl | 200 mM | ||
30 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
31 | H2A.Z-H2B | [U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
32 | Chz1 | [U-30% 2H] | 1.0 ~ 1.2 mM | |
33 | MES | 25 mM | ||
34 | KCl | 200 mM | ||
35 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
37 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
38 | MES | 25 mM | ||
39 | KCl | 200 mM | ||
40 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
41 | Chz1 | [U-100% 15N; U-30%2H] | 1.0 ~ 1.2 mM | |
42 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
43 | MES | 25 mM | ||
44 | KCl | 200 mM | ||
45 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
46 | Chz1 | [U-100% 13C; U-35%2H] | 1.0 ~ 1.2 mM | |
47 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
48 | MES | 25 mM | ||
49 | KCl | 200 mM | ||
50 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
51 | Chz1 | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
52 | H2A.Z-H2B | [U-100%15N; U-100% 2H] | 1.0 ~ 1.2 mM | |
53 | MES | 25 mM | ||
54 | KCl | 200 mM | ||
55 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
56 | H2A.Z-H2B | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
57 | Chz1 | [U-100% 13C; U-100% 15N; U-100%2H] | 1.0 ~ 1.2 mM | |
58 | MES | 25 mM | ||
59 | KCl | 200 mM | ||
60 | EDTA | 1 mM |
Solvent system 90% H2O/10% D2O or 100%D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
61 | Chz1 | [U-10% 13C; U-100% 15N] | 1.0 ~ 1.2 mM | |
62 | H2A.Z-H2B | [U-100% 2H] | 1.0 ~ 1.2 mM | |
63 | MES | 25 mM | ||
64 | KCl | 200 mM | ||
65 | EDTA | 1 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15393_2jss.nef |
Input source #2: Coordindates | 2jss.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 RKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSSTQAQSSSA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| RKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSSTQAQSSSA -------110-------120-------130-------140-------150-------160-------170-------180-------190-- RAGLQFPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDELDSLIRATIASGGVLPHI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| RAGLQFPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDELDSLIRATIASGGVLPHI
--------10--------20--------30--------40--------50--------60-- TVEDSESDMDDAKLDALMGNEGEEEEDDLAEIDTSNIITSGRRTRGKVIDYKKTAEELDKKE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| TVEDSESDMDDAKLDALMGNEGEEEEDDLAEIDTSNIITSGRRTRGKVIDYKKTAEELDKKE
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 192 | 0 | 0 | 100.0 |
B | B | 62 | 0 | 0 | 100.0 |
Content subtype: combined_15393_2jss.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 RKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSSTQAQSSSA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| RKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSSTQAQSSSA -------110-------120-------130-------140-------150-------160-------170-------180-------190-- RAGLQFPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDELDSLIRATIASGGVLPHI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| RAGLQFPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDELDSLIRATIASGGVLPHI
--------10--------20--------30--------40--------50--------60-- TVEDSESDMDDAKLDALMGNEGEEEEDDLAEIDTSNIITSGRRTRGKVIDYKKTAEELDKKE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| TVEDSESDMDDAKLDALMGNEGEEEEDDLAEIDTSNIITSGRRTRGKVIDYKKTAEELDKKE
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
6 | SER | HG | 5.685 |
23 | SER | HG | 5.703 |
26 | SER | HG | 5.708 |
28 | SER | HG | 5.693 |
46 | SER | HG | 5.455 |
55 | SER | HG | 5.664 |
58 | SER | HG | 5.693 |
90 | SER | HG | 5.54 |
91 | SER | HG | 5.67 |
92 | SER | HG | 5.71 |
97 | SER | HG | 5.69 |
98 | SER | HG | 5.7 |
127 | SER | HG | 5.69 |
177 | SER | HG | 5.879 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 865 | 733 | 84.7 |
1H chemical shifts | 1143 | 863 | 75.5 |
15N chemical shifts | 213 | 186 | 87.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 384 | 374 | 97.4 |
1H chemical shifts | 390 | 377 | 96.7 |
15N chemical shifts | 187 | 184 | 98.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 481 | 359 | 74.6 |
1H chemical shifts | 753 | 486 | 64.5 |
15N chemical shifts | 26 | 2 | 7.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 129 | 102 | 79.1 |
1H chemical shifts | 129 | 123 | 95.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 57 | 0 | 0.0 |
1H chemical shifts | 57 | 24 | 42.1 |
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
5 | SER | HG | 5.708 |
7 | SER | HG | 5.69 |
35 | SER | HG | 5.693 |
40 | SER | HG | 5.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 258 | 246 | 95.3 |
1H chemical shifts | 353 | 258 | 73.1 |
15N chemical shifts | 67 | 65 | 97.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 124 | 123 | 99.2 |
1H chemical shifts | 128 | 122 | 95.3 |
15N chemical shifts | 62 | 61 | 98.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 134 | 123 | 91.8 |
1H chemical shifts | 225 | 136 | 60.4 |
15N chemical shifts | 5 | 4 | 80.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 31 | 28 | 90.3 |
1H chemical shifts | 31 | 27 | 87.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 4 | 0 | 0.0 |
1H chemical shifts | 4 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 RKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSSTQAQSSSA |||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .KETYSSYIYKVLKQTHPDTGIS.KSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSSTQAQSSSA -------110-------120-------130-------140-------150-------160-------170-------180-------190-- RAGLQFPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDELDSLIRATIASGGVLPHI |||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| RAGL.FPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDELDSLIRATIASGGVLPHI
--------10--------20--------30--------40--------50--------60-- TVEDSESDMDDAKLDALMGNEGEEEEDDLAEIDTSNIITSGRRTRGKVIDYKKTAEELDKKE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .VEDSESDMDDAKLDALMGNEGEEEEDDLAEIDTSNIITSGRRTRGKVIDYKKTAEELDKKE
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 RKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSSTQAQSSSA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .KETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSSTQAQSSSA -------110-------120-------130-------140-------150-------160-------170-------180-------190-- RAGLQFPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDELDSLIRATIASGGVLPHI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| RAGLQFPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDELDSLIRATIASGGVLPHI
--------10--------20--------30--------40--------50--------60-- TVEDSESDMDDAKLDALMGNEGEEEEDDLAEIDTSNIITSGRRTRGKVIDYKKTAEELDKKE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .VEDSESDMDDAKLDALMGNEGEEEEDDLAEIDTSNIITSGRRTRGKVIDYKKTAEELDKKE
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 RKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSSTQAQSSSA ||||||||||| |||||||||||||||||||||||||||| ||||||||||| |||||||||||||||||||| | .....SSYIYKVLKQT.......QKSMSILNSFVNDIFERIATEASKLAAY.......AREIQTAVRLI..GELAKHAVSEGTRAVTKYSS......S.. --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160-------170-------180-------190-- RAGLQFPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDELDSLIRATIASGGVLPHI | ||||||||||| ||||||||||||||||||||||||| ||||||||| || || .A....PVGRIKRYLKR...........AAIYLTAVLEYLTAEVLELAGNAAK.........RHLQLAIRG.DE..SL -------110-------120-------130-------140-------150-------160-------170--------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 RKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSSTQAQSSSA |||||||||| |||||||||||||||||||||||||||||||| |||||||||||||| |||||||||||||||||||| ||| .....SSYIYKVLKQ......ISQKSMSILNSFVNDIFERIATEASKLAAYNK...ISAREIQTAVRLIL.GELAKHAVSEGTRAVTKYSS......SSA --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160-------170-------180-------190-- RAGLQFPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDELDSLIRATIASGGVLPHI ||||| ||||||||||| ||| ||||||||||||||||||||| ||||| |||||| |||||||||||| RAGLQ...GRIKRYLKRHA.....VGS.AAIYLTAVLEYLTAEVLELAG.AAKDL.......RHLQLA..GDDELDSLIRAT -------110-------120-------130-------140-------150-------160-------170-------180--