Multienzyme Docking in Hybrid Megasynthetases
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.2 % (811 of 861) | 94.2 % (423 of 449) | 93.7 % (312 of 333) | 96.2 % (76 of 79) |
Backbone | 95.8 % (437 of 456) | 97.5 % (157 of 161) | 94.6 % (211 of 223) | 95.8 % (69 of 72) |
Sidechain | 93.2 % (440 of 472) | 92.4 % (266 of 288) | 94.4 % (167 of 177) | 100.0 % (7 of 7) |
Aromatic | 100.0 % (30 of 30) | 100.0 % (15 of 15) | 100.0 % (14 of 14) | 100.0 % (1 of 1) |
Methyl | 95.1 % (97 of 102) | 96.1 % (49 of 51) | 94.1 % (48 of 51) |
1. TubCdd
GPLGSSAGAL LAHAASLGVR LWVEGERLRF QAPPGVMTPE LQSRLGGARH ELIALLRQLQ PSSQGGSLLA PVARNGRLSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TubCdd | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | TSP | natural abundance | 20 uM | |
3 | sodium azide | natural abundance | 0.1 % | |
4 | sodium phosphate | natural abundance | 50 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | H2O | 90 % | ||
7 | D2O | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6, Details This was a mixed labelled sample of unlabelled and labelled protein prepared by mixing, thermal denaturation and refolding by cooling to room temperature
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | TubCdd | [U-100% 13C; U-100% 15N] | 0.5 mM | |
9 | TubCdd | natural abundance | 0.5 mM | |
10 | TSP | natural abundance | 20 uM | |
11 | sodium azide | natural abundance | 0.1 % | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | TubCdd | natural abundance | 0.5 mM | |
15 | H2O | 90 % | ||
16 | D2O | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TMS | methyl carbon | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TMS | methyl carbon | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TMS | methyl carbon | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TMS | methyl carbon | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TubCdd | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | TSP | natural abundance | 20 uM | |
3 | sodium azide | natural abundance | 0.1 % | |
4 | sodium phosphate | natural abundance | 50 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | H2O | 90 % | ||
7 | D2O | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TubCdd | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | TSP | natural abundance | 20 uM | |
3 | sodium azide | natural abundance | 0.1 % | |
4 | sodium phosphate | natural abundance | 50 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | H2O | 90 % | ||
7 | D2O | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6, Details This was a mixed labelled sample of unlabelled and labelled protein prepared by mixing, thermal denaturation and refolding by cooling to room temperature
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | TubCdd | [U-100% 13C; U-100% 15N] | 0.5 mM | |
9 | TubCdd | natural abundance | 0.5 mM | |
10 | TSP | natural abundance | 20 uM | |
11 | sodium azide | natural abundance | 0.1 % | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | TubCdd | natural abundance | 0.5 mM | |
15 | H2O | 90 % | ||
16 | D2O | 10 % |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TubCdd | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | TSP | natural abundance | 20 uM | |
3 | sodium azide | natural abundance | 0.1 % | |
4 | sodium phosphate | natural abundance | 50 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | H2O | 90 % | ||
7 | D2O | 10 % |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TubCdd | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | TSP | natural abundance | 20 uM | |
3 | sodium azide | natural abundance | 0.1 % | |
4 | sodium phosphate | natural abundance | 50 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | H2O | 90 % | ||
7 | D2O | 10 % |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TubCdd | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | TSP | natural abundance | 20 uM | |
3 | sodium azide | natural abundance | 0.1 % | |
4 | sodium phosphate | natural abundance | 50 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | H2O | 90 % | ||
7 | D2O | 10 % |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TubCdd | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | TSP | natural abundance | 20 uM | |
3 | sodium azide | natural abundance | 0.1 % | |
4 | sodium phosphate | natural abundance | 50 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | H2O | 90 % | ||
7 | D2O | 10 % |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TubCdd | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | TSP | natural abundance | 20 uM | |
3 | sodium azide | natural abundance | 0.1 % | |
4 | sodium phosphate | natural abundance | 50 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | H2O | 90 % | ||
7 | D2O | 10 % |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TubCdd | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | TSP | natural abundance | 20 uM | |
3 | sodium azide | natural abundance | 0.1 % | |
4 | sodium phosphate | natural abundance | 50 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | H2O | 90 % | ||
7 | D2O | 10 % |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TubCdd | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | TSP | natural abundance | 20 uM | |
3 | sodium azide | natural abundance | 0.1 % | |
4 | sodium phosphate | natural abundance | 50 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | H2O | 90 % | ||
7 | D2O | 10 % |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TubCdd | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | TSP | natural abundance | 20 uM | |
3 | sodium azide | natural abundance | 0.1 % | |
4 | sodium phosphate | natural abundance | 50 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | H2O | 90 % | ||
7 | D2O | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15442_2jug.nef |
Input source #2: Coordindates | 2jug.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70-------- GPLGSSAGALLAHAASLGVRLWVEGERLRFQAPPGVMTPELQSRLGGARHELIALLRQLQPSSQGGSLLAPVARNGRL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPLGSSAGALLAHAASLGVRLWVEGERLRFQAPPGVMTPELQSRLGGARHELIALLRQLQPSSQGGSLLAPVARNGRL
--------10--------20--------30--------40--------50--------60--------70-------- GPLGSSAGALLAHAASLGVRLWVEGERLRFQAPPGVMTPELQSRLGGARHELIALLRQLQPSSQGGSLLAPVARNGRL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPLGSSAGALLAHAASLGVRLWVEGERLRFQAPPGVMTPELQSRLGGARHELIALLRQLQPSSQGGSLLAPVARNGRL
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 78 | 0 | 0 | 100.0 |
B | B | 78 | 0 | 0 | 100.0 |
Content subtype: combined_15442_2jug.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70-------- GPLGSSAGALLAHAASLGVRLWVEGERLRFQAPPGVMTPELQSRLGGARHELIALLRQLQPSSQGGSLLAPVARNGRL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPLGSSAGALLAHAASLGVRLWVEGERLRFQAPPGVMTPELQSRLGGARHELIALLRQLQPSSQGGSLLAPVARNGRL
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
75 | ASN | CG | 177.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 449 | 417 | 92.9 |
13C chemical shifts | 333 | 307 | 92.2 |
15N chemical shifts | 87 | 75 | 86.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 161 | 156 | 96.9 |
13C chemical shifts | 156 | 143 | 91.7 |
15N chemical shifts | 72 | 68 | 94.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 288 | 261 | 90.6 |
13C chemical shifts | 177 | 164 | 92.7 |
15N chemical shifts | 15 | 7 | 46.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 52 | 49 | 94.2 |
13C chemical shifts | 52 | 48 | 92.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 15 | 15 | 100.0 |
13C chemical shifts | 14 | 14 | 100.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70-------- GPLGSSAGALLAHAASLGVRLWVEGERLRFQAPPGVMTPELQSRLGGARHELIALLRQLQPSSQGGSLLAPVARNGRL |||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPLG.SAGALLAHAASLGVRLWVEGERLRFQAPPGVMTPELQSRLGGARHELIALLRQLQPSSQGGSLLAPVARNGRL
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70-------- GPLGSSAGALLAHAASLGVRLWVEGERLRFQAPPGVMTPELQSRLGGARHELIALLRQLQPSSQGGSLLAPVARNGRL ||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......AGALLAHAASLGVRLWVEGERLRFQAPPGVMTPELQSRLGGARHELIALLRQLQP --------10--------20--------30--------40--------50--------60-