solution structure of DNA binding domain of ngTRF1
PVNQKSKRSE LSQRRIRRPF SVAEVEALVE AVEHLGTGRW RDVKMRAFDN ADHRTYVDLK DKWKTLVHTA SIAPQQRRGE PVPQDLLDRV LAAHAYWSQQ QGKQHVEPLK ILDAKAQKVG A
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 69.9 % (1010 of 1445) | 61.5 % (469 of 762) | 77.0 % (426 of 553) | 88.5 % (115 of 130) |
Backbone | 93.3 % (666 of 714) | 84.2 % (203 of 241) | 98.0 % (351 of 358) | 97.4 % (112 of 115) |
Sidechain | 54.0 % (457 of 847) | 51.1 % (266 of 521) | 60.5 % (188 of 311) | 20.0 % (3 of 15) |
Aromatic | 14.1 % (13 of 92) | 21.7 % (10 of 46) | 0.0 % (0 of 43) | 100.0 % (3 of 3) |
Methyl | 77.6 % (104 of 134) | 79.1 % (53 of 67) | 76.1 % (51 of 67) |
1. NgTRF1
PVNQKSKRSE LSQRRIRRPF SVAEVEALVE AVEHLGTGRW RDVKMRAFDN ADHRTYVDLK DKWKTLVHTA SIAPQQRRGE PVPQDLLDRV LAAHAYWSQQ QGKQHVEPLK ILDAKAQKVG ASolvent system 25mM Sodium phosphate, 100mM NaCl, pH 7, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NgTRF1 | [U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | NaCl | 100 mM | ||
4 | H2O | 90 % | ||
5 | D2O | 10 % |
Solvent system 25mM Sodium phosphate, 100mM NaCl, pH 7, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | NgTRF1 | [U-100% 13C; U-100% 15N] | 1 mM | |
7 | sodium phosphate | natural abundance | 25 mM | |
8 | NaCl | 100 mM | ||
9 | H2O | 90 % | ||
10 | D2O | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
Bruker DRX - 500 MHz with Cryo-probe
State isotropic, Solvent system 25mM Sodium phosphate, 100mM NaCl, pH 7, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NgTRF1 | [U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | NaCl | 100 mM | ||
4 | H2O | 90 % | ||
5 | D2O | 10 % |
Bruker DRX - 500 MHz with Cryo-probe
State isotropic, Solvent system 25mM Sodium phosphate, 100mM NaCl, pH 7, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NgTRF1 | [U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | NaCl | 100 mM | ||
4 | H2O | 90 % | ||
5 | D2O | 10 % |
Bruker DRX - 500 MHz with Cryo-probe
State isotropic, Solvent system 25mM Sodium phosphate, 100mM NaCl, pH 7, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NgTRF1 | [U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | NaCl | 100 mM | ||
4 | H2O | 90 % | ||
5 | D2O | 10 % |
Bruker DRX - 500 MHz with Cryo-probe
State isotropic, Solvent system 25mM Sodium phosphate, 100mM NaCl, pH 7, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NgTRF1 | [U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | NaCl | 100 mM | ||
4 | H2O | 90 % | ||
5 | D2O | 10 % |
Bruker DRX - 500 MHz with Cryo-probe
State isotropic, Solvent system 25mM Sodium phosphate, 100mM NaCl, pH 7, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NgTRF1 | [U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | NaCl | 100 mM | ||
4 | H2O | 90 % | ||
5 | D2O | 10 % |
Bruker DRX - 500 MHz with Cryo-probe
State isotropic, Solvent system 25mM Sodium phosphate, 100mM NaCl, pH 7, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NgTRF1 | [U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | NaCl | 100 mM | ||
4 | H2O | 90 % | ||
5 | D2O | 10 % |
Bruker DRX - 500 MHz with Cryo-probe
State isotropic, Solvent system 25mM Sodium phosphate, 100mM NaCl, pH 7, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NgTRF1 | [U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | NaCl | 100 mM | ||
4 | H2O | 90 % | ||
5 | D2O | 10 % |
Bruker DRX - 500 MHz with Cryo-probe
State isotropic, Solvent system 25mM Sodium phosphate, 100mM NaCl, pH 7, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NgTRF1 | [U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | NaCl | 100 mM | ||
4 | H2O | 90 % | ||
5 | D2O | 10 % |
Bruker DRX - 500 MHz with Cryo-probe
State isotropic, Solvent system 25mM Sodium phosphate, 100mM NaCl, pH 7, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NgTRF1 | [U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | NaCl | 100 mM | ||
4 | H2O | 90 % | ||
5 | D2O | 10 % |
Bruker DRX - 500 MHz with Cryo-probe
State isotropic, Solvent system 25mM Sodium phosphate, 100mM NaCl, pH 7, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NgTRF1 | [U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | NaCl | 100 mM | ||
4 | H2O | 90 % | ||
5 | D2O | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15444_2juh.nef |
Input source #2: Coordindates | 2juh.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660 PVNQKSKRSELSQRRIRRPFSVAEVEALVEAVEHLGTGRWRDVKMRAFDNADHRTYVDLKDKWKTLVHTASIAPQQRRGEPVPQDLLDRVLAAHAYWSQQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| PVNQKSKRSELSQRRIRRPFSVAEVEALVEAVEHLGTGRWRDVKMRAFDNADHRTYVDLKDKWKTLVHTASIAPQQRRGEPVPQDLLDRVLAAHAYWSQQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------670-------680- QGKQHVEPLKILDAKAQKVGA ||||||||||||||||||||| QGKQHVEPLKILDAKAQKVGA -------110-------120-
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 121 | 0 | 0 | 100.0 |
Content subtype: combined_15444_2juh.nef
Assigned chemical shifts
-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660 PVNQKSKRSELSQRRIRRPFSVAEVEALVEAVEHLGTGRWRDVKMRAFDNADHRTYVDLKDKWKTLVHTASIAPQQRRGEPVPQDLLDRVLAAHAYWSQQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| PVNQKSKRSELSQRRIRRPFSVAEVEALVEAVEHLGTGRWRDVKMRAFDNADHRTYVDLKDKWKTLVHTASIAPQQRRGEPVPQDLLDRVLAAHAYWSQQ -------670-------680- QGKQHVEPLKILDAKAQKVGA ||||||||||||||||||||| QGKQHVEPLKILDAKAQKVGA
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 553 | 423 | 76.5 |
1H chemical shifts | 762 | 450 | 59.1 |
15N chemical shifts | 142 | 114 | 80.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 242 | 238 | 98.3 |
1H chemical shifts | 241 | 198 | 82.2 |
15N chemical shifts | 115 | 111 | 96.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 311 | 185 | 59.5 |
1H chemical shifts | 521 | 252 | 48.4 |
15N chemical shifts | 27 | 3 | 11.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 68 | 51 | 75.0 |
1H chemical shifts | 68 | 50 | 73.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 43 | 0 | 0.0 |
1H chemical shifts | 46 | 10 | 21.7 |
15N chemical shifts | 3 | 3 | 100.0 |
Distance restraints
-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660 PVNQKSKRSELSQRRIRRPFSVAEVEALVEAVEHLGTGRWRDVKMRAFDNADHRTYVDLKDKWKTLVHTASIAPQQRRGEPVPQDLLDRVLAAHAYWSQQ || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||| .VN................FSVAEVEALVEAVEHLGTGRWRDVKMRAFDNADHRTYVDLKDKWKTLVHTASIAPQQRR.EPVPQDLLDRVLAAHAYWSQQ -------570-------580-------590-------600-------610-------620-------630-------640-------650-------660 -------670-------680- QGKQHVEPLKILDAKAQKVGA | || Q....VE -------
Dihedral angle restraints
-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660 PVNQKSKRSELSQRRIRRPFSVAEVEALVEAVEHLGTGRWRDVKMRAFDNADHRTYVDLKDKWKTLVHTASIAPQQRRGEPVPQDLLDRVLAAHAYWSQQ ||||||||||||||||| ||| ||| ||| |||| | |||||||| ||| |||||||||||||||||| || |||| | | |||||||| | ||||| .VNQKSKRSELSQRRIRR.FSV.EVE.LVE.VEHL.T.RWRDVKMR.FDN.DHRTYVDLKDKWKTLVHT.SI..QQRR.E.V.QDLLDRVL..H.YWSQQ -------570-------580-------590-------600-------610-------620-------630-------640-------650-------660 -------670-------680- QGKQHVEPLKILDAKAQKVGA | ||||| ||||| | ||| Q.KQHVE.LKILD.K.QKV -------670---------