NMR Solution Structure of homodimer protein SO_2176 from Shewanella oneidensis. Northeast Structural Genomics Consortium Target SoR77.
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.4 % (866 of 927) | 93.1 % (446 of 479) | 93.4 % (338 of 362) | 95.3 % (82 of 86) |
Backbone | 95.0 % (452 of 476) | 94.3 % (150 of 159) | 95.4 % (228 of 239) | 94.9 % (74 of 78) |
Sidechain | 92.5 % (490 of 530) | 92.5 % (296 of 320) | 92.1 % (186 of 202) | 100.0 % (8 of 8) |
Aromatic | 56.0 % (28 of 50) | 56.0 % (14 of 25) | 56.0 % (14 of 25) | |
Methyl | 100.0 % (104 of 104) | 100.0 % (52 of 52) | 100.0 % (52 of 52) |
1. protein
MAIQSKYSNT QVESLIAEIL VVLEKHKAPT DLSLMALGNC VTHLLERKVP SESRQAVAEQ FAKALAQSVK SNLEHHHHHHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±2.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.5) mM | |
5 | DTT | natural abundance | 10 (±1.0) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.002) % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 5.5 (±0.1), Details 50% NC labeled and 50% unlabeled protein mixed together to form mixed homodimer
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | protein | [U-100% 13C; U-100% 15N] | 0.5 (±0.05) mM | |
8 | protein | natural abundance | 0.5 (±0.05) mM | |
9 | sodium chloride | natural abundance | 100 (±10.0) mM | |
10 | ammonium acetate | natural abundance | 20 (±2.0) mM | |
11 | calcium chloride | natural abundance | 5 (±0.5) mM | |
12 | DTT | natural abundance | 10 (±1.0) mM | |
13 | sodium azide | natural abundance | 0.02 (±0.002) % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
14 | protein | [U-5% 13C; U-100% 15N] | 1 (±0.1) mM | |
15 | sodium chloride | natural abundance | 100 (±10.0) mM | |
16 | ammonium acetate | natural abundance | 20 (±2.0) mM | |
17 | calcium chloride | natural abundance | 5 (±0.5) mM | |
18 | DTT | natural abundance | 10 (±1.0) mM | |
19 | sodium azide | natural abundance | 0.02 (±0.002) % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
20 | protein | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
21 | sodium chloride | natural abundance | 100 (±10.0) mM | |
22 | ammonium acetate | natural abundance | 20 (±2.0) mM | |
23 | calcium chloride | natural abundance | 5 (±0.5) mM | |
24 | DTT | natural abundance | 10 (±1.0) mM | |
25 | sodium azide | natural abundance | 0.02 (±0.002) % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±2.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.5) mM | |
5 | DTT | natural abundance | 10 (±1.0) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.002) % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±2.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.5) mM | |
5 | DTT | natural abundance | 10 (±1.0) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.002) % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±2.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.5) mM | |
5 | DTT | natural abundance | 10 (±1.0) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.002) % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±2.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.5) mM | |
5 | DTT | natural abundance | 10 (±1.0) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.002) % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
20 | protein | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
21 | sodium chloride | natural abundance | 100 (±10.0) mM | |
22 | ammonium acetate | natural abundance | 20 (±2.0) mM | |
23 | calcium chloride | natural abundance | 5 (±0.5) mM | |
24 | DTT | natural abundance | 10 (±1.0) mM | |
25 | sodium azide | natural abundance | 0.02 (±0.002) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±2.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.5) mM | |
5 | DTT | natural abundance | 10 (±1.0) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.002) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±2.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.5) mM | |
5 | DTT | natural abundance | 10 (±1.0) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.002) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±2.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.5) mM | |
5 | DTT | natural abundance | 10 (±1.0) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.002) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 5.5 (±0.1), Details 50% NC labeled and 50% unlabeled protein mixed together to form mixed homodimer
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | protein | [U-100% 13C; U-100% 15N] | 0.5 (±0.05) mM | |
8 | protein | natural abundance | 0.5 (±0.05) mM | |
9 | sodium chloride | natural abundance | 100 (±10.0) mM | |
10 | ammonium acetate | natural abundance | 20 (±2.0) mM | |
11 | calcium chloride | natural abundance | 5 (±0.5) mM | |
12 | DTT | natural abundance | 10 (±1.0) mM | |
13 | sodium azide | natural abundance | 0.02 (±0.002) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 5.5 (±0.1), Details 50% NC labeled and 50% unlabeled protein mixed together to form mixed homodimer
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | protein | [U-100% 13C; U-100% 15N] | 0.5 (±0.05) mM | |
8 | protein | natural abundance | 0.5 (±0.05) mM | |
9 | sodium chloride | natural abundance | 100 (±10.0) mM | |
10 | ammonium acetate | natural abundance | 20 (±2.0) mM | |
11 | calcium chloride | natural abundance | 5 (±0.5) mM | |
12 | DTT | natural abundance | 10 (±1.0) mM | |
13 | sodium azide | natural abundance | 0.02 (±0.002) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 5.5 (±0.1), Details 50% NC labeled and 50% unlabeled protein mixed together to form mixed homodimer
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | protein | [U-100% 13C; U-100% 15N] | 0.5 (±0.05) mM | |
8 | protein | natural abundance | 0.5 (±0.05) mM | |
9 | sodium chloride | natural abundance | 100 (±10.0) mM | |
10 | ammonium acetate | natural abundance | 20 (±2.0) mM | |
11 | calcium chloride | natural abundance | 5 (±0.5) mM | |
12 | DTT | natural abundance | 10 (±1.0) mM | |
13 | sodium azide | natural abundance | 0.02 (±0.002) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±2.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.5) mM | |
5 | DTT | natural abundance | 10 (±1.0) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.002) % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
14 | protein | [U-5% 13C; U-100% 15N] | 1 (±0.1) mM | |
15 | sodium chloride | natural abundance | 100 (±10.0) mM | |
16 | ammonium acetate | natural abundance | 20 (±2.0) mM | |
17 | calcium chloride | natural abundance | 5 (±0.5) mM | |
18 | DTT | natural abundance | 10 (±1.0) mM | |
19 | sodium azide | natural abundance | 0.02 (±0.002) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
20 | protein | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
21 | sodium chloride | natural abundance | 100 (±10.0) mM | |
22 | ammonium acetate | natural abundance | 20 (±2.0) mM | |
23 | calcium chloride | natural abundance | 5 (±0.5) mM | |
24 | DTT | natural abundance | 10 (±1.0) mM | |
25 | sodium azide | natural abundance | 0.02 (±0.002) % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 5.5 (±0.1), Details 50% NC labeled and 50% unlabeled protein mixed together to form mixed homodimer
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | protein | [U-100% 13C; U-100% 15N] | 0.5 (±0.05) mM | |
8 | protein | natural abundance | 0.5 (±0.05) mM | |
9 | sodium chloride | natural abundance | 100 (±10.0) mM | |
10 | ammonium acetate | natural abundance | 20 (±2.0) mM | |
11 | calcium chloride | natural abundance | 5 (±0.5) mM | |
12 | DTT | natural abundance | 10 (±1.0) mM | |
13 | sodium azide | natural abundance | 0.02 (±0.002) % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
14 | protein | [U-5% 13C; U-100% 15N] | 1 (±0.1) mM | |
15 | sodium chloride | natural abundance | 100 (±10.0) mM | |
16 | ammonium acetate | natural abundance | 20 (±2.0) mM | |
17 | calcium chloride | natural abundance | 5 (±0.5) mM | |
18 | DTT | natural abundance | 10 (±1.0) mM | |
19 | sodium azide | natural abundance | 0.02 (±0.002) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 5.5 (±0.1), Details 50% NC labeled and 50% unlabeled protein mixed together to form mixed homodimer
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | protein | [U-100% 13C; U-100% 15N] | 0.5 (±0.05) mM | |
8 | protein | natural abundance | 0.5 (±0.05) mM | |
9 | sodium chloride | natural abundance | 100 (±10.0) mM | |
10 | ammonium acetate | natural abundance | 20 (±2.0) mM | |
11 | calcium chloride | natural abundance | 5 (±0.5) mM | |
12 | DTT | natural abundance | 10 (±1.0) mM | |
13 | sodium azide | natural abundance | 0.02 (±0.002) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
20 | protein | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
21 | sodium chloride | natural abundance | 100 (±10.0) mM | |
22 | ammonium acetate | natural abundance | 20 (±2.0) mM | |
23 | calcium chloride | natural abundance | 5 (±0.5) mM | |
24 | DTT | natural abundance | 10 (±1.0) mM | |
25 | sodium azide | natural abundance | 0.02 (±0.002) % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | ammonium acetate | natural abundance | 20 (±2.0) mM | |
4 | calcium chloride | natural abundance | 5 (±0.5) mM | |
5 | DTT | natural abundance | 10 (±1.0) mM | |
6 | sodium azide | natural abundance | 0.02 (±0.002) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
20 | protein | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
21 | sodium chloride | natural abundance | 100 (±10.0) mM | |
22 | ammonium acetate | natural abundance | 20 (±2.0) mM | |
23 | calcium chloride | natural abundance | 5 (±0.5) mM | |
24 | DTT | natural abundance | 10 (±1.0) mM | |
25 | sodium azide | natural abundance | 0.02 (±0.002) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
20 | protein | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
21 | sodium chloride | natural abundance | 100 (±10.0) mM | |
22 | ammonium acetate | natural abundance | 20 (±2.0) mM | |
23 | calcium chloride | natural abundance | 5 (±0.5) mM | |
24 | DTT | natural abundance | 10 (±1.0) mM | |
25 | sodium azide | natural abundance | 0.02 (±0.002) % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±1) K, pH 5.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
20 | protein | [U-100% 13C; U-100% 15N] | 1 (±0.1) mM | |
21 | sodium chloride | natural abundance | 100 (±10.0) mM | |
22 | ammonium acetate | natural abundance | 20 (±2.0) mM | |
23 | calcium chloride | natural abundance | 5 (±0.5) mM | |
24 | DTT | natural abundance | 10 (±1.0) mM | |
25 | sodium azide | natural abundance | 0.02 (±0.002) % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15456_2juw.nef |
Input source #2: Coordindates | 2juw.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80 MAIQSKYSNTQVESLIAEILVVLEKHKAPTDLSLMALGNCVTHLLERKVPSESRQAVAEQFAKALAQSVKSNLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAIQSKYSNTQVESLIAEILVVLEKHKAPTDLSLMALGNCVTHLLERKVPSESRQAVAEQFAKALAQSVKSNLEHHHHHH
--------10--------20--------30--------40--------50--------60--------70--------80 MAIQSKYSNTQVESLIAEILVVLEKHKAPTDLSLMALGNCVTHLLERKVPSESRQAVAEQFAKALAQSVKSNLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAIQSKYSNTQVESLIAEILVVLEKHKAPTDLSLMALGNCVTHLLERKVPSESRQAVAEQFAKALAQSVKSNLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 80 | 0 | 0 | 100.0 |
B | B | 80 | 0 | 0 | 100.0 |
Content subtype: combined_15456_2juw.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80 MAIQSKYSNTQVESLIAEILVVLEKHKAPTDLSLMALGNCVTHLLERKVPSESRQAVAEQFAKALAQSVKSNLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AIQSKYSNTQVESLIAEILVVLEKHKAPTDLSLMALGNCVTHLLERKVPSESRQAVAEQFAKALAQSVKSNLEHHHH --------10--------20--------30--------40--------50--------60--------70--------
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
4 | GLN | CD | 180.5 |
9 | ASN | CG | 176.5 |
11 | GLN | CD | 179.8 |
39 | ASN | CG | 175.9 |
43 | HIS | ND1 | 184.3 |
43 | HIS | NE2 | 195.8 |
54 | ARG | HH11 | 7.26 |
54 | ARG | HH12 | 7.26 |
54 | ARG | HH21 | 7.26 |
54 | ARG | HH22 | 7.26 |
55 | GLN | CD | 179.5 |
60 | GLN | CD | 180.1 |
67 | GLN | CD | 180.2 |
72 | ASN | CG | 176.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 479 | 446 | 93.1 |
13C chemical shifts | 362 | 337 | 93.1 |
15N chemical shifts | 88 | 84 | 95.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 159 | 150 | 94.3 |
13C chemical shifts | 160 | 151 | 94.4 |
15N chemical shifts | 78 | 74 | 94.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 320 | 296 | 92.5 |
13C chemical shifts | 202 | 186 | 92.1 |
15N chemical shifts | 10 | 10 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 53 | 98.1 |
13C chemical shifts | 54 | 53 | 98.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 25 | 14 | 56.0 |
13C chemical shifts | 25 | 14 | 56.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80 MAIQSKYSNTQVESLIAEILVVLEKHKAPTDLSLMALGNCVTHLLERKVPSESRQAVAEQFAKALAQSVKSNLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....SKYSNTQVESLIAEILVVLEKHKAPTDLSLMALGNCVTHLLERKVPSESRQAVAEQFAKALAQSVKSNLE --------10--------20--------30--------40--------50--------60--------70----
--------10--------20--------30--------40--------50--------60--------70--------80 MAIQSKYSNTQVESLIAEILVVLEKHKAPTDLSLMALGNCVTHLLERKVPSESRQAVAEQFAKALAQSVKSNLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....SKYSNTQVESLIAEILVVLEKHKAPTDLSLMALGNCVTHLLERKVPSESRQAVAEQFAKALAQSVKSNLE --------10--------20--------30--------40--------50--------60--------70----
--------10--------20--------30--------40--------50--------60--------70--------80 MAIQSKYSNTQVESLIAEILVVLEKHKAPTDLSLMALGNCVTHLLERKVPSESRQAVAEQFAKALAQSVKSNLEHHHHHH ||||||||||||||||| |||||||| || ||||||||||||||| ........NTQVESLIAEILVVLEK.....DLSLMALG.CV.............QAVAEQFAKALAQSV --------10--------20--------30--------40--------50--------60---------
--------10--------20--------30--------40--------50--------60--------70--------80 MAIQSKYSNTQVESLIAEILVVLEKHKAPTDLSLMALGNCVTHLLERKVPSESRQAVAEQFAKALAQSVKSNLEHHHHHH ||||||||||||||||| |||||||| || |||||||||||||||| ........NTQVESLIAEILVVLEK.....DLSLMALG.CV............RQAVAEQFAKALAQSV --------10--------20--------30--------40--------50--------60---------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80 MAIQSKYSNTQVESLIAEILVVLEKHKAPTDLSLMALGNCVTHLLERKVPSESRQAVAEQFAKALAQSVKSNLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .......SNTQVESLIAEILVVLEKHKAPTDLSLMALGNCVTHLLERKVPSESRQAVAEQFAKALAQSVKSNLE --------10--------20--------30--------40--------50--------60--------70----
--------10--------20--------30--------40--------50--------60--------70--------80 MAIQSKYSNTQVESLIAEILVVLEKHKAPTDLSLMALGNCVTHLLERKVPSESRQAVAEQFAKALAQSVKSNLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .......SNTQVESLIAEILVVLEKHKAPTDLSLMALGNCVTHLLERKVPSESRQAVAEQFAKALAQSVKSNLE --------10--------20--------30--------40--------50--------60--------70----