NMR Structure of Peptidyl-tRNA hydrolase domain protein from Pseudomonas syringae pv. tomato:Northeast Structural Genomics Consortium Target PsR211
MLVISNNVHL PDAEIELTAI RAQGAGGQNV NKVSSAMHLR FDINASSLPP FYKERLLALN DSRITSDGVI VLKAQQYRTQ EQNRADALLR LSELIVNAAK LEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.1 % (1173 of 1247) | 94.9 % (613 of 646) | 92.9 % (448 of 482) | 94.1 % (112 of 119) |
Backbone | 95.5 % (613 of 642) | 95.4 % (207 of 217) | 95.6 % (306 of 320) | 95.2 % (100 of 105) |
Sidechain | 93.1 % (660 of 709) | 94.6 % (406 of 429) | 91.0 % (242 of 266) | 85.7 % (12 of 14) |
Aromatic | 52.9 % (36 of 68) | 64.7 % (22 of 34) | 41.2 % (14 of 34) | |
Methyl | 100.0 % (142 of 142) | 100.0 % (71 of 71) | 100.0 % (71 of 71) |
1. Peptidyl-tRNA hydrolase domain protein
MLVISNNVHL PDAEIELTAI RAQGAGGQNV NKVSSAMHLR FDINASSLPP FYKERLLALN DSRITSDGVI VLKAQQYRTQ EQNRADALLR LSELIVNAAK LEHHHHHHPressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Peptidyl-tRNA hydrolase domain protein | [U-100% 13C; U-100% 15N] | 1.28 mM | |
2 | CaCl2 | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | NH4OAc | natural abundance | 20 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian INOVA - 750 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Peptidyl-tRNA hydrolase domain protein | [U-100% 13C; U-100% 15N] | 1.28 mM | |
2 | CaCl2 | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | NH4OAc | natural abundance | 20 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 750 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Peptidyl-tRNA hydrolase domain protein | [U-100% 13C; U-100% 15N] | 1.28 mM | |
2 | CaCl2 | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | NH4OAc | natural abundance | 20 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 750 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Peptidyl-tRNA hydrolase domain protein | [U-100% 13C; U-100% 15N] | 1.28 mM | |
2 | CaCl2 | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | NH4OAc | natural abundance | 20 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 750 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Peptidyl-tRNA hydrolase domain protein | [U-100% 13C; U-100% 15N] | 1.28 mM | |
2 | CaCl2 | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | NH4OAc | natural abundance | 20 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 750 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Peptidyl-tRNA hydrolase domain protein | [U-100% 13C; U-100% 15N] | 1.28 mM | |
2 | CaCl2 | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | NH4OAc | natural abundance | 20 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 750 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Peptidyl-tRNA hydrolase domain protein | [U-100% 13C; U-100% 15N] | 1.28 mM | |
2 | CaCl2 | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | NH4OAc | natural abundance | 20 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 750 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Peptidyl-tRNA hydrolase domain protein | [U-100% 13C; U-100% 15N] | 1.28 mM | |
2 | CaCl2 | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | NH4OAc | natural abundance | 20 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Varian INOVA - 750 MHz
State isotropic, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Peptidyl-tRNA hydrolase domain protein | [U-100% 13C; U-100% 15N] | 1.28 mM | |
2 | CaCl2 | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | NH4OAc | natural abundance | 20 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15471_2jva.nef |
Input source #2: Coordindates | 2jva.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MLVISNNVHLPDAEIELTAIRAQGAGGQNVNKVSSAMHLRFDINASSLPPFYKERLLALNDSRITSDGVIVLKAQQYRTQEQNRADALLRLSELIVNAAK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MLVISNNVHLPDAEIELTAIRAQGAGGQNVNKVSSAMHLRFDINASSLPPFYKERLLALNDSRITSDGVIVLKAQQYRTQEQNRADALLRLSELIVNAAK -------- LEHHHHHH |||||||| LEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 108 | 0 | 0 | 100.0 |
Content subtype: combined_15471_2jva.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MLVISNNVHLPDAEIELTAIRAQGAGGQNVNKVSSAMHLRFDINASSLPPFYKERLLALNDSRITSDGVIVLKAQQYRTQEQNRADALLRLSELIVNAAK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MLVISNNVHLPDAEIELTAIRAQGAGGQNVNKVSSAMHLRFDINASSLPPFYKERLLALNDSRITSDGVIVLKAQQYRTQEQNRADALLRLSELIVNAAK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------- LEHHHHHH ||||| LEHHH -----
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
46 | SER | HG | 5.273 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 646 | 615 | 95.2 |
13C chemical shifts | 482 | 446 | 92.5 |
15N chemical shifts | 126 | 116 | 92.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 217 | 209 | 96.3 |
13C chemical shifts | 216 | 204 | 94.4 |
15N chemical shifts | 105 | 100 | 95.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 429 | 406 | 94.6 |
13C chemical shifts | 266 | 242 | 91.0 |
15N chemical shifts | 21 | 16 | 76.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 73 | 73 | 100.0 |
13C chemical shifts | 73 | 73 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 34 | 22 | 64.7 |
13C chemical shifts | 34 | 14 | 41.2 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MLVISNNVHLPDAEIELTAIRAQGAGGQNVNKVSSAMHLRFDINASSLPPFYKERLLALNDSRITSDGVIVLKAQQYRTQEQNRADALLRLSELIVNAAK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MLVISNNVHLPDAEIELTAIRAQGAGGQNVNKVSSAMHLRFDINASSLPPFYKERLLALNDSRITSDGVIVLKAQQYRTQEQNRADALLRLSELIVNAAK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------- LEHHHHHH ||| LEH ---
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MLVISNNVHLPDAEIELTAIRAQGAGGQNVNKVSSAMHLRFDINASSLPPFYKERLLALNDSRITSDGVIVLKAQQYRTQEQNRADALLRLSELIVNAAK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MLVISNNVHLPDAEIELTAIRAQGAGGQNVNKVSSAMHLRFDINASSLPPFYKERLLALNDSRITSDGVIVLKAQQYRTQEQNRADALLRLSELIVNAAK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------- LEHHHHHH || LE --