Solution structure of the extracellular domain of Prod1, a protein implicated in proximodistal identity during amphibian limb regeneration
MGSSHHHHHH SSGLVPRGSH MALKCFTRNG DDRTVTTCAE EQTRCLFVQL PYSEIQECKT VQQCAEVLEE VTAIGYPAKC CCEDLCNRSE Q
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS25:SG | 1:CYS45:SG |
2 | disulfide | sing | 1:CYS38:SG | 1:CYS58:SG |
3 | disulfide | sing | 1:CYS64:SG | 1:CYS80:SG |
4 | disulfide | sing | 1:CYS81:SG | 1:CYS86:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 76.8 % (770 of 1003) | 75.6 % (393 of 520) | 78.8 % (305 of 387) | 75.0 % (72 of 96) |
Backbone | 78.9 % (426 of 540) | 77.2 % (142 of 184) | 79.9 % (214 of 268) | 79.5 % (70 of 88) |
Sidechain | 75.4 % (414 of 549) | 74.7 % (251 of 336) | 78.5 % (161 of 205) | 25.0 % (2 of 8) |
Aromatic | 43.8 % (28 of 64) | 43.8 % (14 of 32) | 43.8 % (14 of 32) | |
Methyl | 87.5 % (70 of 80) | 87.5 % (35 of 40) | 87.5 % (35 of 40) |
1. Prod1
MGSSHHHHHH SSGLVPRGSH MALKCFTRNG DDRTVTTCAE EQTRCLFVQL PYSEIQECKT VQQCAEVLEE VTAIGYPAKC CCEDLCNRSE QSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Prod1 | [U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | Prod1 | [U-13C; U-15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | sodium chloride | natural abundance | 150 mM | |
10 | EDTA | natural abundance | 1 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | Prod1 | [U-13C; U-15N] | 1 mM | |
14 | sodium phosphate | natural abundance | 50 mM | |
15 | sodium chloride | natural abundance | 150 mM | |
16 | EDTA | natural abundance | 1 mM | |
17 | D2O | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Prod1 | [U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | Prod1 | [U-13C; U-15N] | 1 mM | |
14 | sodium phosphate | natural abundance | 50 mM | |
15 | sodium chloride | natural abundance | 150 mM | |
16 | EDTA | natural abundance | 1 mM | |
17 | D2O | 100 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Prod1 | [U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | Prod1 | [U-13C; U-15N] | 1 mM | |
14 | sodium phosphate | natural abundance | 50 mM | |
15 | sodium chloride | natural abundance | 150 mM | |
16 | EDTA | natural abundance | 1 mM | |
17 | D2O | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | Prod1 | [U-13C; U-15N] | 1 mM | |
14 | sodium phosphate | natural abundance | 50 mM | |
15 | sodium chloride | natural abundance | 150 mM | |
16 | EDTA | natural abundance | 1 mM | |
17 | D2O | 100 % |
Varian UnityPlus - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | Prod1 | [U-13C; U-15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | sodium chloride | natural abundance | 150 mM | |
10 | EDTA | natural abundance | 1 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | Prod1 | [U-13C; U-15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | sodium chloride | natural abundance | 150 mM | |
10 | EDTA | natural abundance | 1 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | Prod1 | [U-13C; U-15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | sodium chloride | natural abundance | 150 mM | |
10 | EDTA | natural abundance | 1 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | Prod1 | [U-13C; U-15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | sodium chloride | natural abundance | 150 mM | |
10 | EDTA | natural abundance | 1 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | Prod1 | [U-13C; U-15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | sodium chloride | natural abundance | 150 mM | |
10 | EDTA | natural abundance | 1 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | Prod1 | [U-13C; U-15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | sodium chloride | natural abundance | 150 mM | |
10 | EDTA | natural abundance | 1 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | Prod1 | [U-13C; U-15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | sodium chloride | natural abundance | 150 mM | |
10 | EDTA | natural abundance | 1 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | Prod1 | [U-13C; U-15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | sodium chloride | natural abundance | 150 mM | |
10 | EDTA | natural abundance | 1 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | Prod1 | [U-13C; U-15N] | 1 mM | |
14 | sodium phosphate | natural abundance | 50 mM | |
15 | sodium chloride | natural abundance | 150 mM | |
16 | EDTA | natural abundance | 1 mM | |
17 | D2O | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | Prod1 | [U-13C; U-15N] | 1 mM | |
14 | sodium phosphate | natural abundance | 50 mM | |
15 | sodium chloride | natural abundance | 150 mM | |
16 | EDTA | natural abundance | 1 mM | |
17 | D2O | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Prod1 | [U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15477_2jve.nef |
Input source #2: Coordindates | 2jve.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
A:22:CYS:SG | A:42:CYS:SG | oxidized, CA 51.68, CB 41.829 ppm | oxidized, CA 51.956, CB 38.526 ppm | 2.03 |
A:35:CYS:SG | A:55:CYS:SG | oxidized, CA 52.962, CB 37.439 ppm | oxidized, CA 57.749, CB 45.523 ppm | 2.026 |
A:61:CYS:SG | A:77:CYS:SG | oxidized, CA 64.735, CB 40.828 ppm | oxidized, CA 56.029, CB 47.796 ppm | 2.025 |
A:78:CYS:SG | A:83:CYS:SG | oxidized, CA 54.237, CB 47.557 ppm | oxidized, CA 57.206, CB 47.155 ppm | 2.029 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-----------10--------20--------30--------40--------50--------60--------70--------80-------- MGSSHHHHHHSSGLVPRGSHMALKCFTRNGDDRTVTTCAEEQTRCLFVQLPYSEIQECKTVQQCAEVLEEVTAIGYPAKCCCEDLCNRSEQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHHHHHHSSGLVPRGSHMALKCFTRNGDDRTVTTCAEEQTRCLFVQLPYSEIQECKTVQQCAEVLEEVTAIGYPAKCCCEDLCNRSEQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 91 | 0 | 0 | 100.0 |
Content subtype: combined_15477_2jve.nef
Assigned chemical shifts
-----------10--------20--------30--------40--------50--------60--------70--------80-------- MGSSHHHHHHSSGLVPRGSHMALKCFTRNGDDRTVTTCAEEQTRCLFVQLPYSEIQECKTVQQCAEVLEEVTAIGYPAKCCCEDLCNRSEQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....................MALKCFTRNGDDRTVTTCAEEQTRCLFVQLPYSEIQECKTVQQCAEVLEEVTAIGYPAKCCCEDLCNRSEQ
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 520 | 389 | 74.8 |
13C chemical shifts | 387 | 300 | 77.5 |
15N chemical shifts | 101 | 69 | 68.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 184 | 142 | 77.2 |
13C chemical shifts | 182 | 142 | 78.0 |
15N chemical shifts | 88 | 69 | 78.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 336 | 247 | 73.5 |
13C chemical shifts | 205 | 158 | 77.1 |
15N chemical shifts | 13 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 42 | 36 | 85.7 |
13C chemical shifts | 42 | 36 | 85.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 32 | 14 | 43.8 |
13C chemical shifts | 32 | 14 | 43.8 |
Covalent bonds
Distance restraints
-----------10--------20--------30--------40--------50--------60--------70--------80-------- MGSSHHHHHHSSGLVPRGSHMALKCFTRNGDDRTVTTCAEEQTRCLFVQLPYSEIQECKTVQQCAEVLEEVTAIGYPAKCCCEDLCNRSEQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....................MALKCFTRNGDDRTVTTCAEEQTRCLFVQLPYSEIQECKTVQQCAEVLEEVTAIGYPAKCCCEDLCNRSEQ
Dihedral angle restraints
-----------10--------20--------30--------40--------50--------60--------70--------80-------- MGSSHHHHHHSSGLVPRGSHMALKCFTRNGDDRTVTTCAEEQTRCLFVQLPYSEIQECKTVQQCAEVLEEVTAIGYPAKCCCEDLCNRSEQ ||||||||||||||||||| |||||||| ||||||| ||||||||||||||| |||||||| .....................ALKCFTRNGDDRTVTTCAE..TRCLFVQL..SEIQECK.VQQCAEVLEEVTAIG.PAKCCCED -----------10--------20--------30--------40--------50--------60--------70--------80-