Solution NMR structure of uncharacterized protein Q5E7H1 from Vibrio fischeri. Northeast Structural Genomics target VfR117.
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.1 % (1008 of 1119) | 89.8 % (530 of 590) | 90.0 % (387 of 430) | 91.9 % (91 of 99) |
Backbone | 91.0 % (477 of 524) | 90.3 % (159 of 176) | 91.6 % (240 of 262) | 90.7 % (78 of 86) |
Sidechain | 89.6 % (610 of 681) | 89.6 % (371 of 414) | 89.0 % (226 of 254) | 100.0 % (13 of 13) |
Aromatic | 65.4 % (68 of 104) | 65.4 % (34 of 52) | 64.0 % (32 of 50) | 100.0 % (2 of 2) |
Methyl | 100.0 % (92 of 92) | 100.0 % (46 of 46) | 100.0 % (46 of 46) |
1. VfR117
MALIMTQQNN PLHGITLQKL LTELVEHYGW EELSYMVNIN CFKKDPSIKS SLKFLRKTDW ARERVENIYL KLQRHKERNQ LEHHHHHHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VfR117 | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | VfR117 | [U-5% 13C; U-100% 15N] | 1.08 mM | |
8 | ammonium acetate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | calcium chloride | natural abundance | 5 mM | |
11 | DTT | natural abundance | 10 mM | |
12 | sodium azide | natural abundance | 0.02 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VfR117 | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VfR117 | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VfR117 | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VfR117 | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VfR117 | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VfR117 | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VfR117 | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VfR117 | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VfR117 | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VfR117 | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VfR117 | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VfR117 | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VfR117 | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | VfR117 | [U-5% 13C; U-100% 15N] | 1.08 mM | |
8 | ammonium acetate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | calcium chloride | natural abundance | 5 mM | |
11 | DTT | natural abundance | 10 mM | |
12 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VfR117 | [U-100% 13C; U-100% 15N] | 0.95 mM | |
2 | ammonium acetate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15491_2jvw.nef |
Input source #2: Coordindates | 2jvw.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80-------- MALIMTQQNNPLHGITLQKLLTELVEHYGWEELSYMVNINCFKKDPSIKSSLKFLRKTDWARERVENIYLKLQRHKERNQLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MALIMTQQNNPLHGITLQKLLTELVEHYGWEELSYMVNINCFKKDPSIKSSLKFLRKTDWARERVENIYLKLQRHKERNQLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 88 | 0 | 0 | 100.0 |
Content subtype: combined_15491_2jvw.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80-------- MALIMTQQNNPLHGITLQKLLTELVEHYGWEELSYMVNINCFKKDPSIKSSLKFLRKTDWARERVENIYLKLQRHKERNQLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .ALIMTQQNNPLHGITLQKLLTELVEHYGWEELSYMVNINCFKKDPSIKSSLKFLRKTDWARERVENIYLKLQRHKERNQLE --------10--------20--------30--------40--------50--------60--------70--------80--
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
7 | GLN | CD | 180.365 |
8 | GLN | CD | 180.365 |
9 | ASN | CG | 176.851 |
10 | ASN | CG | 177.227 |
18 | GLN | CD | 178.977 |
38 | ASN | CG | 177.822 |
40 | ASN | CG | 175.764 |
67 | ASN | CG | 176.088 |
73 | GLN | CD | 179.365 |
79 | ASN | CG | 176.851 |
80 | GLN | CD | 180.365 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 590 | 537 | 91.0 |
13C chemical shifts | 430 | 388 | 90.2 |
15N chemical shifts | 104 | 94 | 90.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 176 | 161 | 91.5 |
13C chemical shifts | 176 | 162 | 92.0 |
15N chemical shifts | 86 | 78 | 90.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 414 | 376 | 90.8 |
13C chemical shifts | 254 | 226 | 89.0 |
15N chemical shifts | 18 | 16 | 88.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 49 | 47 | 95.9 |
13C chemical shifts | 49 | 47 | 95.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 52 | 34 | 65.4 |
13C chemical shifts | 50 | 32 | 64.0 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80-------- MALIMTQQNNPLHGITLQKLLTELVEHYGWEELSYMVNINCFKKDPSIKSSLKFLRKTDWARERVENIYLKLQRHKERNQLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .ALIMTQQNNPLHGITLQKLLTELVEHYGWEELSYMVNINCFKKDPSIKSSLKFLRKTDWARERVENIYLKLQRHKERNQLE --------10--------20--------30--------40--------50--------60--------70--------80--
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80-------- MALIMTQQNNPLHGITLQKLLTELVEHYGWEELSYMVNINCFKKDPSIKSSLKFLRKTDWARERVENIYLKLQRHKERNQLEHHHHHH |||||||||||||||||||||| ||||||||||||||||||||||||||||| ...............TLQKLLTELVEHYGWEELSYMV.........SIKSSLKFLRKTDWARERVENIYLKLQRH --------10--------20--------30--------40--------50--------60--------70-----