Solution structure of the protease-resistent domain of Xenopus ePABP2
AIAPCMQTTH SKMTAGAYTE GPPQPLSAEE KKEIDKRSVY VGNVDYGSTA QDLEAHFSSC GSINRITILC DKFSGHPKGY AYIEFAERNS VDAAVAMDET VFRGRTIKVL PKRTNMPGIS STDR
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 85.8 % (1184 of 1380) | 83.7 % (599 of 716) | 85.9 % (464 of 540) | 97.6 % (121 of 124) |
Backbone | 97.1 % (709 of 730) | 95.6 % (239 of 250) | 97.5 % (354 of 363) | 99.1 % (116 of 117) |
Sidechain | 77.0 % (589 of 765) | 77.3 % (360 of 466) | 76.7 % (224 of 292) | 71.4 % (5 of 7) |
Aromatic | 46.7 % (43 of 92) | 76.1 % (35 of 46) | 17.4 % (8 of 46) | |
Methyl | 90.0 % (108 of 120) | 88.3 % (53 of 60) | 91.7 % (55 of 60) |
1. ePABP2-trp
AIAPCMQTTH SKMTAGAYTE GPPQPLSAEE KKEIDKRSVY VGNVDYGSTA QDLEAHFSSC GSINRITILC DKFSGHPKGY AYIEFAERNS VDAAVAMDET VFRGRTIKVL PKRTNMPGIS STDRSolvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.0, Details 10 mM sodium acetate, 100 mM NaCl,90% H2O, 10% D2O,1.0 mM 13,15N-ePABP2-trp
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ePABP2-trp | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | NaAc | natural abundance | 10 mM |
Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.0, Details 10 mM sodium acetate, 100 mM NaCl,90% H2O,10% D2O,0.5 mM 13C,15N-ePABP2-trp, 0.5 mM Unlabeled ePABP2-trp
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | ePABP2-trp | [U-100% 13C; U-100% 15N] | 0.5 mM | |
5 | ePABP2-trp | natural abundance | 0.5 mM | |
6 | NaCl | natural abundance | 100 mM | |
7 | NaAc | natural abundance | 10 mM |
Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.0, Details 5% PEG, 10 mM sodium acetate, 100 mM NaCl, 90% H2O, 10% D2O, 0.5 mM 15N-ePABP2-trp
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | ePABP2-trp | [U-100% 15N] | 0.5 mM | |
9 | PEG | natural abundance | 5 % | |
10 | NaCl | natural abundance | 100 mM | |
11 | NaAc | natural abundance | 10 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.0, Details 10 mM sodium acetate, 100 mM NaCl,90% H2O, 10% D2O,1.0 mM 13,15N-ePABP2-trp
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ePABP2-trp | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | NaAc | natural abundance | 10 mM |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.0, Details 10 mM sodium acetate, 100 mM NaCl,90% H2O, 10% D2O,1.0 mM 13,15N-ePABP2-trp
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ePABP2-trp | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | NaAc | natural abundance | 10 mM |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.0, Details 10 mM sodium acetate, 100 mM NaCl,90% H2O, 10% D2O,1.0 mM 13,15N-ePABP2-trp
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ePABP2-trp | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | NaAc | natural abundance | 10 mM |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.0, Details 10 mM sodium acetate, 100 mM NaCl,90% H2O, 10% D2O,1.0 mM 13,15N-ePABP2-trp
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ePABP2-trp | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | NaAc | natural abundance | 10 mM |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.0, Details 10 mM sodium acetate, 100 mM NaCl,90% H2O, 10% D2O,1.0 mM 13,15N-ePABP2-trp
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ePABP2-trp | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | NaAc | natural abundance | 10 mM |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.0, Details 10 mM sodium acetate, 100 mM NaCl,90% H2O, 10% D2O,1.0 mM 13,15N-ePABP2-trp
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ePABP2-trp | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | NaAc | natural abundance | 10 mM |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.0, Details 10 mM sodium acetate, 100 mM NaCl,90% H2O, 10% D2O,1.0 mM 13,15N-ePABP2-trp
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ePABP2-trp | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | NaAc | natural abundance | 10 mM |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.0, Details 10 mM sodium acetate, 100 mM NaCl,90% H2O, 10% D2O,1.0 mM 13,15N-ePABP2-trp
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ePABP2-trp | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | NaAc | natural abundance | 10 mM |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.0, Details 10 mM sodium acetate, 100 mM NaCl,90% H2O, 10% D2O,1.0 mM 13,15N-ePABP2-trp
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ePABP2-trp | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | NaAc | natural abundance | 10 mM |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.0, Details 10 mM sodium acetate, 100 mM NaCl,90% H2O, 10% D2O,1.0 mM 13,15N-ePABP2-trp
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ePABP2-trp | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | NaAc | natural abundance | 10 mM |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.0, Details 10 mM sodium acetate, 100 mM NaCl,90% H2O,10% D2O,0.5 mM 13C,15N-ePABP2-trp, 0.5 mM Unlabeled ePABP2-trp
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | ePABP2-trp | [U-100% 13C; U-100% 15N] | 0.5 mM | |
5 | ePABP2-trp | natural abundance | 0.5 mM | |
6 | NaCl | natural abundance | 100 mM | |
7 | NaAc | natural abundance | 10 mM |
Bruker DMX - 750 MHz
State anisotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 302 K, pH 5.0, Details 5% PEG, 10 mM sodium acetate, 100 mM NaCl, 90% H2O, 10% D2O, 0.5 mM 15N-ePABP2-trp
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | ePABP2-trp | [U-100% 15N] | 0.5 mM | |
9 | PEG | natural abundance | 5 % | |
10 | NaCl | natural abundance | 100 mM | |
11 | NaAc | natural abundance | 10 mM |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.0, Details 10 mM sodium acetate, 100 mM NaCl,90% H2O, 10% D2O,1.0 mM 13,15N-ePABP2-trp
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ePABP2-trp | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | NaAc | natural abundance | 10 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_15528_2jwn.nef |
Input source #2: Coordindates | 2jwn.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 AIAPCMQTTHSKMTAGAYTEGPPQPLSAEEKKEIDKRSVYVGNVDYGSTAQDLEAHFSSCGSINRITILCDKFSGHPKGYAYIEFAERNSVDAAVAMDET |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AIAPCMQTTHSKMTAGAYTEGPPQPLSAEEKKEIDKRSVYVGNVDYGSTAQDLEAHFSSCGSINRITILCDKFSGHPKGYAYIEFAERNSVDAAVAMDET -------110-------120---- VFRGRTIKVLPKRTNMPGISSTDR |||||||||||||||||||||||| VFRGRTIKVLPKRTNMPGISSTDR
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 AIAPCMQTTHSKMTAGAYTEGPPQPLSAEEKKEIDKRSVYVGNVDYGSTAQDLEAHFSSCGSINRITILCDKFSGHPKGYAYIEFAERNSVDAAVAMDET |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AIAPCMQTTHSKMTAGAYTEGPPQPLSAEEKKEIDKRSVYVGNVDYGSTAQDLEAHFSSCGSINRITILCDKFSGHPKGYAYIEFAERNSVDAAVAMDET -------110-------120---- VFRGRTIKVLPKRTNMPGISSTDR |||||||||||||||||||||||| VFRGRTIKVLPKRTNMPGISSTDR
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 124 | 0 | 0 | 100.0 |
B | B | 124 | 0 | 0 | 100.0 |
Content subtype: combined_15528_2jwn.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 AIAPCMQTTHSKMTAGAYTEGPPQPLSAEEKKEIDKRSVYVGNVDYGSTAQDLEAHFSSCGSINRITILCDKFSGHPKGYAYIEFAERNSVDAAVAMDET |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AIAPCMQTTHSKMTAGAYTEGPPQPLSAEEKKEIDKRSVYVGNVDYGSTAQDLEAHFSSCGSINRITILCDKFSGHPKGYAYIEFAERNSVDAAVAMDET -------110-------120---- VFRGRTIKVLPKRTNMPGISSTDR |||||||||||||||||||||||| VFRGRTIKVLPKRTNMPGISSTDR
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
37 | ARG | HH11 | 6.616 |
103 | ARG | HH11 | 6.555 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 716 | 603 | 84.2 |
13C chemical shifts | 540 | 460 | 85.2 |
15N chemical shifts | 131 | 124 | 94.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 250 | 243 | 97.2 |
13C chemical shifts | 248 | 238 | 96.0 |
15N chemical shifts | 117 | 116 | 99.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 466 | 360 | 77.3 |
13C chemical shifts | 292 | 222 | 76.0 |
15N chemical shifts | 14 | 8 | 57.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 64 | 55 | 85.9 |
13C chemical shifts | 64 | 54 | 84.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 46 | 34 | 73.9 |
13C chemical shifts | 46 | 8 | 17.4 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 AIAPCMQTTHSKMTAGAYTEGPPQPLSAEEKKEIDKRSVYVGNVDYGSTAQDLEAHFSSCGSINRITILCDKFSGHPKGYAYIEFAERNSVDAAVAMDET |||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .IAPCMQTT.SKMTAGAYTEGPPQPLSAEEKKEIDKRSVYVGNVDYGSTAQDLEAHFSSCGSINRITILCDKFSGHPKGYAYIEFAERNSVDAAVAMDET -------110-------120---- VFRGRTIKVLPKRTNMPGISSTDR |||||||||||||||||||||||| VFRGRTIKVLPKRTNMPGISSTDR
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 AIAPCMQTTHSKMTAGAYTEGPPQPLSAEEKKEIDKRSVYVGNVDYGSTAQDLEAHFSSCGSINRITILCDKFSGHPKGYAYIEFAERNSVDAAVAMDET |||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .IAPCMQTT.SKMTAGAYTEGPPQPLSAEEKKEIDKRSVYVGNVDYGSTAQDLEAHFSSCGSINRITILCDKFSGHPKGYAYIEFAERNSVDAAVAMDET -------110-------120---- VFRGRTIKVLPKRTNMPGISSTDR |||||||||||||||||||||||| VFRGRTIKVLPKRTNMPGISSTDR
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 AIAPCMQTTHSKMTAGAYTEGPPQPLSAEEKKEIDKRSVYVGNVDYGSTAQDLEAHFSSCGSINRITILCDKFSGHPKGYAYIEFAERNSVDAAVAMDET ||| ||||||||||||||||||||||||| ||||||||||||| |||||||||||||||||||||| ||||||||||||| AIA..................PPQPLSAEEKKEIDKRSVYVGNVDY.STAQDLEAHFSSC...NRITILCDKFSGHPKGYAYIEF.ERNSVDAAVAMDE. -------110-------120---- VFRGRTIKVLPKRTNMPGISSTDR |||||||||||| || VFRGRTIKVLPK..........DR
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 AIAPCMQTTHSKMTAGAYTEGPPQPLSAEEKKEIDKRSVYVGNVDYGSTAQDLEAHFSSCGSINRITILCDKFSGHPKGYAYIEFAERNSVDAAVAMDET ||| ||||||||||||||||||||||||| ||||||||||||| |||||||||||||||||||||| ||||||||||||| AIA..................PPQPLSAEEKKEIDKRSVYVGNVDY.STAQDLEAHFSSC...NRITILCDKFSGHPKGYAYIEF.ERNSVDAAVAMDE. -------110-------120---- VFRGRTIKVLPKRTNMPGISSTDR |||||||||||| || VFRGRTIKVLPK..........DR
RDC restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 AIAPCMQTTHSKMTAGAYTEGPPQPLSAEEKKEIDKRSVYVGNVDYGSTAQDLEAHFSSCGSINRITILCDKFSGHPKGYAYIEFAERNSVDAAVAMDET ||| | ||||||||||||||||||||| ||||||||||||||||||||||||||||| ||||||||||||||||||||||| ..................TEG..Q.LSAEEKKEIDKRSVYVGNVDY.STAQDLEAHFSSCGSINRITILCDKFSGH.KGYAYIEFAERNSVDAAVAMDET --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120---- VFRGRTIKVLPKRTNMPGISSTDR |||||||||| || VFRGRTIKVL.KR -------110---
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 AIAPCMQTTHSKMTAGAYTEGPPQPLSAEEKKEIDKRSVYVGNVDYGSTAQDLEAHFSSCGSINRITILCDKFSGHPKGYAYIEFAERNSVDAAVAMDET ||| | ||| ||||||||||||||||| ||||| ||||||||||||||||||||||| ||||||||||||||||||||||| ..................TEG..Q.LSA.EKKEIDKRSVYVGNVDY.STAQD.EAHFSSCGSINRITILCDKFSGH.KGYAYIEFAERNSVDAAVAMDET --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120---- VFRGRTIKVLPKRTNMPGISSTDR |||||||||| || VFRGRTIKVL.KR -------110---