BMRBj - BMREntryMaster

Found 1 Document (0.805 seconds)

BMRB: 15533

2JPA

Structure of the Wilms' Tumor Suppressor Protein Zinc Finger Domain Bound to DNA

Authors

Stoll, R., Lee, B.M., Debler, E.W., Laity, J.H., Wilson, I.A., Dyson, H.JANE., Wright, P.E.

Assembly

wt1-zf14-14mer

Entity

1. wt1-zf14 (polymer, Thiol state: all other bound), 119 monomers, 14448.38 Da Detail

ASEKRPFMCA YPGCNKRYFK LSHLQMHSRK HTGEKPYQCD FKDCERRFSR SDQLKRHQRR HTGVKPFQCK TCQRKFSRSD HLKTHTRTHT GEKPFSCRWP SCQKKFARSD ELVRHHNMH

2. ZN (non-polymer), 65.409 × 4 Da
3. wt1-14mer 1 (polymer, Thiol state: not present), 14 monomers, 4416.773 Da Detail

CGCGGGGGCG TCTG

4. wt1-14mer 2 (polymer, Thiol state: not present), 14 monomers, 4274.705 Da Detail

CAGACGCCCC CGCG

Total weight

23401.494 Da

Max. entity weight

14448.38 Da

Entity Connection

na 16 Detail

ID	Type	Value order	Atom ID 1	Atom ID 2
1	na	sing	1:CYS9:SG	2:ZN1:ZN
2	na	sing	1:CYS14:SG	2:ZN1:ZN
3	na	sing	1:HIS27:NE2	2:ZN1:ZN
4	na	sing	1:HIS31:NE2	2:ZN1:ZN
5	na	sing	1:CYS39:SG	2:ZN1:ZN
6	na	sing	1:CYS44:SG	2:ZN1:ZN
7	na	sing	1:HIS57:NE2	2:ZN1:ZN
8	na	sing	1:HIS61:NE2	2:ZN1:ZN
9	na	sing	1:CYS69:SG	2:ZN1:ZN
10	na	sing	1:CYS72:SG	2:ZN1:ZN
11	na	sing	1:HIS85:NE2	2:ZN1:ZN
12	na	sing	1:HIS89:NE2	2:ZN1:ZN
13	na	sing	1:CYS97:SG	2:ZN1:ZN
14	na	sing	1:CYS102:SG	2:ZN1:ZN
15	na	sing	1:HIS115:NE2	2:ZN1:ZN
16	na	sing	1:HIS119:NE2	2:ZN1:ZN

Source organism

Homo sapiens

Exptl. method

solution NMR

Refine. method

molecular dynamics

Data set

assigned_chemical_shifts

Chem. Shift Complete

Sequence coverage: 74.8 %, Completeness: 20.3 %, Completeness (bb): 39.8 % Detail

Polymer type: polypeptide(L) polydeoxyribonucleotide

	Total	¹H	¹⁵N
All	20.3 % (243 of 1195)	11.9 % (128 of 1072)	93.5 % (115 of 123)
Backbone	39.8 % (217 of 545)	25.2 % (109 of 432)	95.6 % (108 of 113)
Sidechain	4.0 % (26 of 650)	3.0 % (19 of 640)	70.0 % (7 of 10)
Aromatic	1.5 % (2 of 137)	0.7 % (1 of 136)	100.0 % (1 of 1)
Methyl	0.0 % (0 of 26)	0.0 % (0 of 26)

1. wt1-zf14

ASEKRPFMCA YPGCNKRYFK LSHLQMHSRK HTGEKPYQCD FKDCERRFSR SDQLKRHQRR HTGVKPFQCK TCQRKFSRSD HLKTHTRTHT GEKPFSCRWP SCQKKFARSD ELVRHHNMH

3. wt1-14mer 1

CGCGGGGGCG TCTG

4. wt1-14mer 2

CAGACGCCCC CGCG

Show sample condition

Sample

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.7

#	Name	Isotope labeling	Concentration
1	wt1-14mer	[U-100% 13C; U-100% 15N]	0.6 mM
2	Tris/HCl		10 mM
3	KCl		20 mM
4	ZnSO4		5 uM
5	NaN3		2 mM

Protein Blocks Logo

Calculated from 20 models in PDB: 2JPA, Strand ID: A Detail

Release date

2008-02-13

Citation

Structure of the Wilms tumor suppressor protein zinc finger domain bound to DNA
Stoll, R., Lee, B.M., Debler, E.W., Laity, J.H., Wilson, I.A., Dyson, H.JANE., Wright, P.E.
J. Mol. Biol. (2007), 372, 1227-1245, PubMed 17716689 , DOI 10.1016/j.jmb.2007.07.017 , Abstract

Related entities 1. wt1-zf14, : 1 : 2 : 2 : 5 : 428 entities Detail

Experiments performed 2 experiments Detail

NMR combined restraints 21 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_15533_2jpa.nef
Input source #2: Coordindates	2jpa.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	True (see coodinates for details)
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

Ptnr_site_1	Ptnr_site_2	Redox_state_prediction_1	Redox_state_prediction_2	Distance (Å)
3:9:CYS:SG	4:1:ZN:ZN	unknown	unknown	n/a
3:14:CYS:SG	4:1:ZN:ZN	unknown	unknown	n/a
3:27:HIS:NE2	4:1:ZN:ZN	unknown	unknown	n/a
3:31:HIS:NE2	4:1:ZN:ZN	unknown	unknown	n/a
3:39:CYS:SG	4:2:ZN:ZN	unknown	unknown	n/a
3:44:CYS:SG	4:2:ZN:ZN	unknown	unknown	n/a
3:57:HIS:NE2	4:2:ZN:ZN	unknown	unknown	n/a
3:61:HIS:NE2	4:2:ZN:ZN	unknown	unknown	n/a
3:69:CYS:SG	4:3:ZN:ZN	unknown	unknown	n/a
3:72:CYS:SG	4:3:ZN:ZN	unknown	unknown	n/a
3:85:HIS:NE2	4:3:ZN:ZN	unknown	unknown	n/a
3:89:HIS:NE2	4:3:ZN:ZN	unknown	unknown	n/a
3:97:CYS:SG	4:4:ZN:ZN	unknown	unknown	n/a
3:102:CYS:SG	4:4:ZN:ZN	unknown	unknown	n/a
3:115:HIS:NE2	4:4:ZN:ZN	unknown	unknown	n/a
3:119:HIS:NE2	4:4:ZN:ZN	unknown	unknown	n/a

Non-standard residues

Chain_ID	Seq_ID	Comp_ID	Chem_comp_name	Experimental evidences
D	1	ZN	ZINC ION	None
D	2	ZN	ZINC ION	None
D	3	ZN	ZINC ION	None
D	4	ZN	ZINC ION	None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A
Entity_assembly_ID (NMR): B vs Auth_asym_ID (model): B

--------10------------120-------130-------
.......................CGCGGGGGCGTCTG
                                     
CAGACGCCCCCGCG.......................

Entity_assembly_ID (NMR): C vs Auth_asym_ID (model): C

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Sequence coverage (%)
B	B	14	100.0
C	C	14	100.0
A	A	119	100.0

Content subtype: combined_15533_2jpa.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Covalent bonds	assembly	OK	16		No information
1	Assigned chemical shifts	assigned_chem_shift_list_1	OK	236		91.6 (chain: A, length: 119)
1	Distance restraints	DYANA/DIANA_distance_constraints_4	Warning	58 (1)	noe	10.9 (chain: A, length: 119)
2	Distance restraints	DYANA/DIANA_distance_constraints_12	Warning	58 (1)	noe	10.9 (chain: A, length: 119)
3	Distance restraints	DYANA/DIANA_distance_constraints_18	OK	405 (1)	undefined	76.5 (chain: A, length: 119)
4	Distance restraints	DYANA/DIANA_distance_constraints_6	Warning	13 (1)	noe	6.7 (chain: A, length: 119)
5	Distance restraints	DYANA/DIANA_distance_constraints_10	Warning	13 (1)	noe	6.7 (chain: A, length: 119)
6	Distance restraints	DYANA/DIANA_distance_constraints_2	Warning	13 (1)	noe	6.7 (chain: A, length: 119)
7	Distance restraints	DYANA/DIANA_distance_constraints_16	Warning	49 (1)	noe	9.2 (chain: A, length: 119)
8	Distance restraints	DYANA/DIANA_distance_constraints_14	Warning	13 (1)	noe	6.7 (chain: A, length: 119)
9	Distance restraints	DYANA/DIANA_distance_constraints_8	Warning	58 (1)	noe	10.9 (chain: A, length: 119)
10	Distance restraints	DYANA/DIANA_distance_constraints_5	Warning	16 (1)	hbond	10.1 (chain: A, length: 119)
11	Distance restraints	DYANA/DIANA_distance_constraints_19	Warning	88 (1)	hbond	53.8 (chain: A, length: 119)
12	Distance restraints	DYANA/DIANA_distance_constraints_17	Warning	16 (1)	hbond	10.1 (chain: A, length: 119)
13	Distance restraints	DYANA/DIANA_distance_constraints_15	Warning	6 (1)	hbond	3.4 (chain: A, length: 119)
14	Distance restraints	DYANA/DIANA_distance_constraints_3	Warning	6 (1)	hbond	3.4 (chain: A, length: 119)
15	Distance restraints	DYANA/DIANA_distance_constraints_13	Warning	16 (1)	hbond	10.1 (chain: A, length: 119)
16	Distance restraints	DYANA/DIANA_distance_constraints_11	Warning	6 (1)	hbond	3.4 (chain: A, length: 119)
17	Distance restraints	DYANA/DIANA_distance_constraints_9	Warning	16 (1)	hbond	10.1 (chain: A, length: 119)
18	Distance restraints	DYANA/DIANA_distance_constraints_7	Warning	6 (1)	hbond	3.4 (chain: A, length: 119)
1	Dihedral angle restraints	DYANA/DIANA_dihedral_20	OK	104 (104)	.	63.9 (chain: A, length: 119)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: OK
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 119, Sequence coverage: 91.6%
- Total number of assignments
  - ¹H chemical shifts: 121
  - ¹⁵N chemical shifts: 115
- Completeness of assignments
  - Entity_assemble_ID: A
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	794	121	15.2
¹⁵N chemical shifts	138	115	83.3

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	236	108	45.8
¹⁵N chemical shifts	113	108	95.6

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	558	13	2.3
¹⁵N chemical shifts	25	7	28.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	27	0	0.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	80	1	1.3
¹⁵N chemical shifts	1	1	100.0

Covalent bonds

Saveframe: assembly
- Status: OK

Distance restraints

Saveframe: DYANA/DIANA_distance_constraints_4
- Status: Warning
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 119, Sequence coverage: 10.9%
- Total number of restraints: 58
- Weight of restraints: 1.0 (58)
- Potential type of restraints: upper-bound-parabolic (58)
- Range of distance target values: 3.0, 5.0 (Å)
- Histogram of distance target values
- Distance restraints per residue
  - Chain_ID: A
  - Chain_ID: B
    None
  - Chain_ID: C
    None
  - Chain_ID: D
    None
- Distance restraints on contact map
- Saveframe: DYANA/DIANA_distance_constraints_12
  - Status: Warning
  - Experiment type: noe
  - Sequence coverage of experimental data
    - Entity_assembly_ID: A, Chain length: 119, Sequence coverage: 10.9%
  - Total number of restraints: 58
  - Weight of restraints: 1.0 (58)
  - Potential type of restraints: upper-bound-parabolic (58)
  - Range of distance target values: 3.0, 5.0 (Å)
  - Histogram of distance target values
  - Distance restraints per residue
    - Chain_ID: A
    - Chain_ID: B
      None
    - Chain_ID: C
      None
    - Chain_ID: D
      None
  - Distance restraints on contact map
  - Saveframe: DYANA/DIANA_distance_constraints_18
    - Status: OK
    - Experiment type: undefined
    - Sequence coverage of experimental data
      - Entity_assembly_ID: A, Chain length: 119, Sequence coverage: 76.5%
    - Total number of restraints: 405
    - Weight of restraints: 1.0 (405)
    - Potential type of restraints: upper-bound-parabolic (405)
    - Range of distance target values: 3.3, 5.0 (Å)
    - Histogram of distance target values
    - Distance restraints per residue
      - Chain_ID: A
      - Chain_ID: B
        None
      - Chain_ID: C
        None
      - Chain_ID: D
        None
    - Distance restraints on contact map
    - Saveframe: DYANA/DIANA_distance_constraints_6
      - Status: Warning
      - Experiment type: noe
      - Sequence coverage of experimental data
        Entity_assembly_ID: A, Chain length: 119, Sequence coverage: 6.7%
      - Total number of restraints: 13
        Sequential restraints, | i - j | = 1 : 6
        Backbone-backbone: 6
        Long range restraints, | i - j | >= 5 : 7
      - Weight of restraints: 1.0 (13)
        Sequential restraints, | i - j | = 1 : 1.0 (6)
        Backbone-backbone: 1.0 (6)
        Long range restraints, | i - j | >= 5 : 1.0 (7)
      - Potential type of restraints: upper-bound-parabolic (13)
        Sequential restraints, | i - j | = 1 : upper-bound-parabolic (6)
        Backbone-backbone: upper-bound-parabolic (6)
        Long range restraints, | i - j | >= 5 : upper-bound-parabolic (7)
      - Range of distance target values: 2.7, 5.0 (Å)
      - Histogram of distance target values
      - Distance restraints per residue
        Chain_ID: A
        Chain_ID: B
        None
        Chain_ID: C
        None
        Chain_ID: D
        None
      - Distance restraints on contact map
      - Saveframe: DYANA/DIANA_distance_constraints_10
        Status: Warning
        Experiment type: noe
        Sequence coverage of experimental data
        Entity_assembly_ID: A, Chain length: 119, Sequence coverage: 6.7%
        Total number of restraints: 13
        Sequential restraints, | i - j | = 1 : 6
        Backbone-backbone: 6
        Long range restraints, | i - j | >= 5 : 7
        Weight of restraints: 1.0 (13)
        Sequential restraints, | i - j | = 1 : 1.0 (6)
        Backbone-backbone: 1.0 (6)
        Long range restraints, | i - j | >= 5 : 1.0 (7)
        Potential type of restraints: upper-bound-parabolic (13)
        Sequential restraints, | i - j | = 1 : upper-bound-parabolic (6)
        Backbone-backbone: upper-bound-parabolic (6)
        Long range restraints, | i - j | >= 5 : upper-bound-parabolic (7)
        Range of distance target values: 2.7, 5.0 (Å)
        Histogram of distance target values
        Distance restraints per residue
        Chain_ID: A
        Chain_ID: B
        None
        Chain_ID: C
        None
        Chain_ID: D
        None
        Distance restraints on contact map
        Saveframe: DYANA/DIANA_distance_constraints_2
        Status: Warning
        Experiment type: noe
        Sequence coverage of experimental data
        Entity_assembly_ID: A, Chain length: 119, Sequence coverage: 6.7%
        Total number of restraints: 13
        Sequential restraints, | i - j | = 1 : 6
        Backbone-backbone: 6
        Long range restraints, | i - j | >= 5 : 7
        Weight of restraints: 1.0 (13)
        Sequential restraints, | i - j | = 1 : 1.0 (6)
        Backbone-backbone: 1.0 (6)
        Long range restraints, | i - j | >= 5 : 1.0 (7)
        Potential type of restraints: upper-bound-parabolic (13)
        Sequential restraints, | i - j | = 1 : upper-bound-parabolic (6)
        Backbone-backbone: upper-bound-parabolic (6)
        Long range restraints, | i - j | >= 5 : upper-bound-parabolic (7)
        Range of distance target values: 2.7, 5.0 (Å)
        Histogram of distance target values
        Distance restraints per residue
        Chain_ID: A
        Chain_ID: B
        None
        Chain_ID: C
        None
        Chain_ID: D
        None
        Distance restraints on contact map
        Saveframe: DYANA/DIANA_distance_constraints_16
        Status: Warning
        Experiment type: noe
        Sequence coverage of experimental data
        Entity_assembly_ID: A, Chain length: 119, Sequence coverage: 9.2%
        Total number of restraints: 49
        Sequential restraints, | i - j | = 1 : 10
        Backbone-backbone: 10
        Medium range restraints, 1 < | i - j | < 5 : 39
        Backbone-backbone: 30
        Backbone-side chain: 9
        Weight of restraints: 1.0 (49)
        Sequential restraints, | i - j | = 1 : 1.0 (10)
        Backbone-backbone: 1.0 (10)
        Medium range restraints, 1 < | i - j | < 5 : 1.0 (39)
        Backbone-backbone: 1.0 (30)
        Backbone-side chain: 1.0 (9)
        Potential type of restraints: upper-bound-parabolic (49)
        Sequential restraints, | i - j | = 1 : upper-bound-parabolic (10)
        Backbone-backbone: upper-bound-parabolic (10)
        Medium range restraints, 1 < | i - j | < 5 : upper-bound-parabolic (39)
        Backbone-backbone: upper-bound-parabolic (30)
        Backbone-side chain: upper-bound-parabolic (9)
        Range of distance target values: 3.0, 5.0 (Å)
        Histogram of distance target values
        Distance restraints per residue
        Chain_ID: A
        Chain_ID: B
        None
        Chain_ID: C
        None
        Chain_ID: D
        None
        Distance restraints on contact map
        Saveframe: DYANA/DIANA_distance_constraints_14
        Status: Warning
        Experiment type: noe
        Sequence coverage of experimental data
        Entity_assembly_ID: A, Chain length: 119, Sequence coverage: 6.7%
        Total number of restraints: 13
        Sequential restraints, | i - j | = 1 : 6
        Backbone-backbone: 6
        Long range restraints, | i - j | >= 5 : 7
        Weight of restraints: 1.0 (13)
        Sequential restraints, | i - j | = 1 : 1.0 (6)
        Backbone-backbone: 1.0 (6)
        Long range restraints, | i - j | >= 5 : 1.0 (7)
        Potential type of restraints: upper-bound-parabolic (13)
        Sequential restraints, | i - j | = 1 : upper-bound-parabolic (6)
        Backbone-backbone: upper-bound-parabolic (6)
        Long range restraints, | i - j | >= 5 : upper-bound-parabolic (7)
        Range of distance target values: 2.7, 5.0 (Å)
        Histogram of distance target values
        Distance restraints per residue
        Chain_ID: A
        Chain_ID: B
        None
        Chain_ID: C
        None
        Chain_ID: D
        None
        Distance restraints on contact map
        Saveframe: DYANA/DIANA_distance_constraints_8
        Status: Warning
        Experiment type: noe
        Sequence coverage of experimental data
        Entity_assembly_ID: A, Chain length: 119, Sequence coverage: 10.9%
        Total number of restraints: 58
        Sequential restraints, | i - j | = 1 : 12
        Backbone-backbone: 12
        Medium range restraints, 1 < | i - j | < 5 : 46
        Backbone-backbone: 36
        Backbone-side chain: 10
        Weight of restraints: 1.0 (58)
        Sequential restraints, | i - j | = 1 : 1.0 (12)
        Backbone-backbone: 1.0 (12)
        Medium range restraints, 1 < | i - j | < 5 : 1.0 (46)
        Backbone-backbone: 1.0 (36)
        Backbone-side chain: 1.0 (10)
        Potential type of restraints: upper-bound-parabolic (58)
        Sequential restraints, | i - j | = 1 : upper-bound-parabolic (12)
        Backbone-backbone: upper-bound-parabolic (12)
        Medium range restraints, 1 < | i - j | < 5 : upper-bound-parabolic (46)
        Backbone-backbone: upper-bound-parabolic (36)
        Backbone-side chain: upper-bound-parabolic (10)
        Range of distance target values: 3.0, 5.0 (Å)
        Histogram of distance target values
        Distance restraints per residue
        Chain_ID: A
        Chain_ID: B
        None
        Chain_ID: C
        None
        Chain_ID: D
        None
        Distance restraints on contact map
        Saveframe: DYANA/DIANA_distance_constraints_5
        Status: Warning
        Experiment type: hbond
        Sequence coverage of experimental data
        Entity_assembly_ID: A, Chain length: 119, Sequence coverage: 10.1%
        Total number of restraints: 16
        Total hydrogen bond restraints: 16
        O...H-x: 8
        O...h-N: 8
        Weight of restraints: 1.0 (16)
        Total hydrogen bond restraints: 1.0 (16)
        O...H-x: 1.0 (8)
        O...h-N: 1.0 (8)
        Potential type of restraints: upper-bound-parabolic (16)
        Total hydrogen bond restraints: upper-bound-parabolic (16)
        O...H-x: upper-bound-parabolic (8)
        O...h-N: upper-bound-parabolic (8)
        Range of distance target values: 2.0, 3.0 (Å)
        Histogram of distance target values
        Distance restraints per residue
        Chain_ID: A
        Chain_ID: B
        None
        Chain_ID: C
        None
        Chain_ID: D
        None
        Distance restraints on contact map
        Saveframe: DYANA/DIANA_distance_constraints_19
        Status: Warning
        Experiment type: hbond
        Sequence coverage of experimental data
        Entity_assembly_ID: A, Chain length: 119, Sequence coverage: 53.8%
        --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ASEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWP | | | | |||||||||||| | | | | |||||||||||| | | | | |||||||||||| | | ......F.C......K.Y.KLSHLQMHSRKH.....Y.C......R.F.RSDQLKRHQRRH.....F.C....R.F.RSDHLKTHTRTH.....F.C... -------110--------- SCQKKFARSDELVRHHNMH | | |||||||||||| ...K.F.RSDELVRHHNMH
        Total number of restraints: 88
        Total hydrogen bond restraints: 88
        O...H-x (too close!): 33
        O...h-N (too close!): 33
        Long range: 22
        O...H-x (too close!): 11
        O...h-N: 8
        O...h-N (too close!): 3
        Weight of restraints: 1.0 (88)
        Total hydrogen bond restraints: 1.0 (88)
        O...H-x (too close!): 1.0 (33)
        O...h-N (too close!): 1.0 (33)
        Long range: 1.0 (22)
        O...H-x (too close!): 1.0 (11)
        O...h-N: 1.0 (8)
        O...h-N (too close!): 1.0 (3)
        Potential type of restraints: upper-bound-parabolic (88)
        Total hydrogen bond restraints: upper-bound-parabolic (88)
        O...H-x (too close!): upper-bound-parabolic (33)
        O...h-N (too close!): upper-bound-parabolic (33)
        Long range: upper-bound-parabolic (22)
        O...H-x (too close!): upper-bound-parabolic (11)
        O...h-N: upper-bound-parabolic (8)
        O...h-N (too close!): upper-bound-parabolic (3)
        Range of distance target values: 1.8, 3.0 (Å)
        Histogram of distance target values
        Distance restraints per residue
        Chain_ID: A
        Chain_ID: B
        None
        Chain_ID: C
        None
        Chain_ID: D
        None
        Distance restraints on contact map
        Chain_ID_1: A - Chain_ID_2: A
        Saveframe: DYANA/DIANA_distance_constraints_17
        Status: Warning
        Experiment type: hbond
        Sequence coverage of experimental data
        Entity_assembly_ID: A, Chain length: 119, Sequence coverage: 10.1%
        Total number of restraints: 16
        Total hydrogen bond restraints: 16
        O...H-x: 8
        O...h-N: 8
        Weight of restraints: 1.0 (16)
        Total hydrogen bond restraints: 1.0 (16)
        O...H-x: 1.0 (8)
        O...h-N: 1.0 (8)
        Potential type of restraints: upper-bound-parabolic (16)
        Total hydrogen bond restraints: upper-bound-parabolic (16)
        O...H-x: upper-bound-parabolic (8)
        O...h-N: upper-bound-parabolic (8)
        Range of distance target values: 2.0, 3.0 (Å)
        Histogram of distance target values
        Distance restraints per residue
        Chain_ID: A
        Chain_ID: B
        None
        Chain_ID: C
        None
        Chain_ID: D
        None
        Distance restraints on contact map
        Saveframe: DYANA/DIANA_distance_constraints_15
        Status: Warning
        Experiment type: hbond
        Sequence coverage of experimental data
        Entity_assembly_ID: A, Chain length: 119, Sequence coverage: 3.4%
        Total number of restraints: 6
        Total hydrogen bond restraints: 6
        Weight of restraints: 1.0 (6)
        Total hydrogen bond restraints: 1.0 (6)
        Potential type of restraints: upper-bound-parabolic (6)
        Total hydrogen bond restraints: upper-bound-parabolic (6)
        Range of distance target values: 2.0, 3.0 (Å)
        Histogram of distance target values
        Distance restraints per residue
        Chain_ID: A
        Chain_ID: B
        None
        Chain_ID: C
        None
        Chain_ID: D
        None
        Distance restraints on contact map
        Saveframe: DYANA/DIANA_distance_constraints_3
        Status: Warning
        Experiment type: hbond
        Sequence coverage of experimental data
        Entity_assembly_ID: A, Chain length: 119, Sequence coverage: 3.4%
        Total number of restraints: 6
        Total hydrogen bond restraints: 6
        Weight of restraints: 1.0 (6)
        Total hydrogen bond restraints: 1.0 (6)
        Potential type of restraints: upper-bound-parabolic (6)
        Total hydrogen bond restraints: upper-bound-parabolic (6)
        Range of distance target values: 2.0, 3.0 (Å)
        Histogram of distance target values
        Distance restraints per residue
        Chain_ID: A
        Chain_ID: B
        None
        Chain_ID: C
        None
        Chain_ID: D
        None
        Distance restraints on contact map
        Saveframe: DYANA/DIANA_distance_constraints_13
        Status: Warning
        Experiment type: hbond
        Sequence coverage of experimental data
        Entity_assembly_ID: A, Chain length: 119, Sequence coverage: 10.1%
        Total number of restraints: 16
        Total hydrogen bond restraints: 16
        O...H-x: 8
        O...h-N: 8
        Weight of restraints: 1.0 (16)
        Total hydrogen bond restraints: 1.0 (16)
        O...H-x: 1.0 (8)
        O...h-N: 1.0 (8)
        Potential type of restraints: upper-bound-parabolic (16)
        Total hydrogen bond restraints: upper-bound-parabolic (16)
        O...H-x: upper-bound-parabolic (8)
        O...h-N: upper-bound-parabolic (8)
        Range of distance target values: 2.0, 3.0 (Å)
        Histogram of distance target values
        Distance restraints per residue
        Chain_ID: A
        Chain_ID: B
        None
        Chain_ID: C
        None
        Chain_ID: D
        None
        Distance restraints on contact map
        Saveframe: DYANA/DIANA_distance_constraints_11
        Status: Warning
        Experiment type: hbond
        Sequence coverage of experimental data
        Entity_assembly_ID: A, Chain length: 119, Sequence coverage: 3.4%
        Total number of restraints: 6
        Total hydrogen bond restraints: 6
        O...H-x: 1
        O...h-N: 1
        Long range: 4
        O...H-x: 2
        O...h-N: 2
        Weight of restraints: 1.0 (6)
        Total hydrogen bond restraints: 1.0 (6)
        O...H-x: 1.0 (1)
        O...h-N: 1.0 (1)
        Long range: 1.0 (4)
        O...H-x: 1.0 (2)
        O...h-N: 1.0 (2)
        Potential type of restraints: upper-bound-parabolic (6)
        Total hydrogen bond restraints: upper-bound-parabolic (6)
        O...H-x: upper-bound-parabolic (1)
        O...h-N: upper-bound-parabolic (1)
        Long range: upper-bound-parabolic (4)
        O...H-x: upper-bound-parabolic (2)
        O...h-N: upper-bound-parabolic (2)
        Range of distance target values: 2.0, 3.0 (Å)
        Histogram of distance target values
        Distance restraints per residue
        Chain_ID: A
        Chain_ID: B
        None
        Chain_ID: C
        None
        Chain_ID: D
        None
        Distance restraints on contact map
        Saveframe: DYANA/DIANA_distance_constraints_9
        Status: Warning
        Experiment type: hbond
        Sequence coverage of experimental data
        Entity_assembly_ID: A, Chain length: 119, Sequence coverage: 10.1%
        Total number of restraints: 16
        Total hydrogen bond restraints: 16
        O...H-x: 8
        O...h-N: 8
        Weight of restraints: 1.0 (16)
        Total hydrogen bond restraints: 1.0 (16)
        O...H-x: 1.0 (8)
        O...h-N: 1.0 (8)
        Potential type of restraints: upper-bound-parabolic (16)
        Total hydrogen bond restraints: upper-bound-parabolic (16)
        O...H-x: upper-bound-parabolic (8)
        O...h-N: upper-bound-parabolic (8)
        Range of distance target values: 2.0, 3.0 (Å)
        Histogram of distance target values
        Distance restraints per residue
        Chain_ID: A
        Chain_ID: B
        None
        Chain_ID: C
        None
        Chain_ID: D
        None
        Distance restraints on contact map
        Saveframe: DYANA/DIANA_distance_constraints_7
        Status: Warning
        Experiment type: hbond
        Sequence coverage of experimental data
        Entity_assembly_ID: A, Chain length: 119, Sequence coverage: 3.4%
        Total number of restraints: 6
        Total hydrogen bond restraints: 6
        Weight of restraints: 1.0 (6)
        Total hydrogen bond restraints: 1.0 (6)
        Potential type of restraints: upper-bound-parabolic (6)
        Total hydrogen bond restraints: upper-bound-parabolic (6)
        Range of distance target values: 2.0, 3.0 (Å)
        Histogram of distance target values
        Distance restraints per residue
        Chain_ID: A
        Chain_ID: B
        None
        Chain_ID: C
        None
        Chain_ID: D
        None
        Distance restraints on contact map

Dihedral angle restraints

Saveframe: DYANA/DIANA_dihedral_20
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 119, Sequence coverage: 63.9%
- Total number of restraints: 104
- Total number of restraints per polymer type: 104
- Weight of restraints: 1.0 (104)
- Potential type of restraints: square-well-parabolic (104)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

Keywords DNA binding, NMR, nucleic acid recognition, residual dipolar coupling, X-ray, zinc finger

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (0.805 seconds)

BMRB: 15533

Sample

Related entities 1. wt1-zf14, : 1 : 2 : 2 : 5 : 428 entities Detail

Experiments performed 2 experiments Detail

Instrument

Sample

Instrument

Sample

NMR combined restraints 21 contents Detail