Solution NMR structures of two designed proteins with 88% sequence identity but different fold and function
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 87.3 % (592 of 678) | 85.1 % (296 of 348) | 88.9 % (240 of 270) | 93.3 % (56 of 60) |
Backbone | 98.2 % (330 of 336) | 97.4 % (111 of 114) | 98.8 % (164 of 166) | 98.2 % (55 of 56) |
Sidechain | 79.8 % (316 of 396) | 79.1 % (185 of 234) | 82.3 % (130 of 158) | 25.0 % (1 of 4) |
Aromatic | 84.2 % (32 of 38) | 89.5 % (17 of 19) | 77.8 % (14 of 18) | 100.0 % (1 of 1) |
Methyl | 70.2 % (66 of 94) | 72.3 % (34 of 47) | 68.1 % (32 of 47) |
1. Ga88
TTYKLILNLK QAKEEAIKEL VDAGIAEKYI KLIANAKTVE GVWTLKDEIL TFTVTESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 (±0.1) K, pH 7 (±0.1), Details 0.2~0.4 mM Ga88 protein + pH7 50 mM sodium phosphate + 50 mM sodium chloride + 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ga88 | [U-100% 13C; U-100% 15N] | 0.2 ~ 0.4 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H20 | natural abundance | 90 % | |
5 | D2O | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker DRX - 600 MHz with a z-axis gradient triple-resonance cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 (±0.1) K, pH 7 (±0.1), Details 0.2~0.4 mM Ga88 protein + pH7 50 mM sodium phosphate + 50 mM sodium chloride + 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ga88 | [U-100% 13C; U-100% 15N] | 0.2 ~ 0.4 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H20 | natural abundance | 90 % | |
5 | D2O | 10 % |
Bruker DRX - 600 MHz with a z-axis gradient triple-resonance cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 (±0.1) K, pH 7 (±0.1), Details 0.2~0.4 mM Ga88 protein + pH7 50 mM sodium phosphate + 50 mM sodium chloride + 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ga88 | [U-100% 13C; U-100% 15N] | 0.2 ~ 0.4 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H20 | natural abundance | 90 % | |
5 | D2O | 10 % |
Bruker DRX - 600 MHz with a z-axis gradient triple-resonance cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 (±0.1) K, pH 7 (±0.1), Details 0.2~0.4 mM Ga88 protein + pH7 50 mM sodium phosphate + 50 mM sodium chloride + 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ga88 | [U-100% 13C; U-100% 15N] | 0.2 ~ 0.4 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H20 | natural abundance | 90 % | |
5 | D2O | 10 % |
Bruker DRX - 600 MHz with a z-axis gradient triple-resonance cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 (±0.1) K, pH 7 (±0.1), Details 0.2~0.4 mM Ga88 protein + pH7 50 mM sodium phosphate + 50 mM sodium chloride + 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ga88 | [U-100% 13C; U-100% 15N] | 0.2 ~ 0.4 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H20 | natural abundance | 90 % | |
5 | D2O | 10 % |
Bruker DRX - 600 MHz with a z-axis gradient triple-resonance cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 (±0.1) K, pH 7 (±0.1), Details 0.2~0.4 mM Ga88 protein + pH7 50 mM sodium phosphate + 50 mM sodium chloride + 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ga88 | [U-100% 13C; U-100% 15N] | 0.2 ~ 0.4 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H20 | natural abundance | 90 % | |
5 | D2O | 10 % |
Bruker DRX - 600 MHz with a z-axis gradient triple-resonance cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 (±0.1) K, pH 7 (±0.1), Details 0.2~0.4 mM Ga88 protein + pH7 50 mM sodium phosphate + 50 mM sodium chloride + 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ga88 | [U-100% 13C; U-100% 15N] | 0.2 ~ 0.4 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H20 | natural abundance | 90 % | |
5 | D2O | 10 % |
Bruker DRX - 600 MHz with a z-axis gradient triple-resonance cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 (±0.1) K, pH 7 (±0.1), Details 0.2~0.4 mM Ga88 protein + pH7 50 mM sodium phosphate + 50 mM sodium chloride + 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ga88 | [U-100% 13C; U-100% 15N] | 0.2 ~ 0.4 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H20 | natural abundance | 90 % | |
5 | D2O | 10 % |
Bruker DRX - 600 MHz with a z-axis gradient triple-resonance cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 (±0.1) K, pH 7 (±0.1), Details 0.2~0.4 mM Ga88 protein + pH7 50 mM sodium phosphate + 50 mM sodium chloride + 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ga88 | [U-100% 13C; U-100% 15N] | 0.2 ~ 0.4 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H20 | natural abundance | 90 % | |
5 | D2O | 10 % |
Bruker DRX - 600 MHz with a z-axis gradient triple-resonance cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 (±0.1) K, pH 7 (±0.1), Details 0.2~0.4 mM Ga88 protein + pH7 50 mM sodium phosphate + 50 mM sodium chloride + 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ga88 | [U-100% 13C; U-100% 15N] | 0.2 ~ 0.4 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H20 | natural abundance | 90 % | |
5 | D2O | 10 % |
Bruker DRX - 600 MHz with a z-axis gradient triple-resonance cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 (±0.1) K, pH 7 (±0.1), Details 0.2~0.4 mM Ga88 protein + pH7 50 mM sodium phosphate + 50 mM sodium chloride + 10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ga88 | [U-100% 13C; U-100% 15N] | 0.2 ~ 0.4 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H20 | natural abundance | 90 % | |
5 | D2O | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15535_2jws.nef |
Input source #2: Coordindates | 2jws.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50------ TTYKLILNLKQAKEEAIKELVDAGIAEKYIKLIANAKTVEGVWTLKDEILTFTVTE |||||||||||||||||||||||||||||||||||||||||||||||||||||||| TTYKLILNLKQAKEEAIKELVDAGIAEKYIKLIANAKTVEGVWTLKDEILTFTVTE
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 56 | 0 | 0 | 100.0 |
Content subtype: combined_15535_2jws.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50------ TTYKLILNLKQAKEEAIKELVDAGIAEKYIKLIANAKTVEGVWTLKDEILTFTVTE |||||||||||||||||||||||||||||||||||||||||||||||||||||||| TTYKLILNLKQAKEEAIKELVDAGIAEKYIKLIANAKTVEGVWTLKDEILTFTVTE
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 270 | 238 | 88.1 |
1H chemical shifts | 348 | 288 | 82.8 |
15N chemical shifts | 60 | 56 | 93.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 112 | 110 | 98.2 |
1H chemical shifts | 114 | 111 | 97.4 |
15N chemical shifts | 56 | 55 | 98.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 158 | 128 | 81.0 |
1H chemical shifts | 234 | 177 | 75.6 |
15N chemical shifts | 4 | 1 | 25.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 47 | 31 | 66.0 |
1H chemical shifts | 47 | 33 | 70.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 18 | 14 | 77.8 |
1H chemical shifts | 19 | 17 | 89.5 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50------ TTYKLILNLKQAKEEAIKELVDAGIAEKYIKLIANAKTVEGVWTLKDEILTFTVTE ||||||||||||||||||||||||||||||||||||||||||||||||||||||| .TYKLILNLKQAKEEAIKELVDAGIAEKYIKLIANAKTVEGVWTLKDEILTFTVTE
--------10--------20--------30--------40--------50------ TTYKLILNLKQAKEEAIKELVDAGIAEKYIKLIANAKTVEGVWTLKDEILTFTVTE ||||||||||||||| |||||||| |||||||||||||| ........LKQAKEEAIKELVDA...EKYIKLIA....VEGVWTLKDEILTF --------10--------20--------30--------40--------50--
Dihedral angle restraints
--------10--------20--------30--------40--------50------ TTYKLILNLKQAKEEAIKELVDAGIAEKYIKLIANAKTVEGVWTLKDEILTFTVTE ||||||||||||||||| ||||||||||| |||||||||||||| .......NLKQAKEEAIKELVDAG.AEKYIKLIANA.TVEGVWTLKDEILT --------10--------20--------30--------40--------50-