Solution NMR Structure of uncharacterized Lipoprotein B from Nitrosomona europaea. Northeast Structural Genomics Target NeR45A.
MGFKLRGQVS ELPFERVYIT APAGLTIGSD LERVISTHTR AKVVNKAEKS EAIIQIVHAI REKRILSLSE SGRVREFELV YRVAARLLDA HNAELASLQE IRLTRILPFL DAQELAKAAE EEMLYKDMQK DAVQQILRQV SAFTSAGLEH HHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.2 % (1664 of 1825) | 89.7 % (850 of 948) | 92.0 % (658 of 715) | 96.3 % (156 of 162) |
Backbone | 95.6 % (883 of 924) | 94.9 % (297 of 313) | 95.9 % (440 of 459) | 96.1 % (146 of 152) |
Sidechain | 87.8 % (922 of 1050) | 87.1 % (553 of 635) | 88.6 % (359 of 405) | 100.0 % (10 of 10) |
Aromatic | 62.7 % (69 of 110) | 65.5 % (36 of 55) | 60.0 % (33 of 55) | |
Methyl | 99.0 % (206 of 208) | 98.1 % (102 of 104) | 100.0 % (104 of 104) |
1. NeR45A
MGFKLRGQVS ELPFERVYIT APAGLTIGSD LERVISTHTR AKVVNKAEKS EAIIQIVHAI REKRILSLSE SGRVREFELV YRVAARLLDA HNAELASLQE IRLTRILPFL DAQELAKAAE EEMLYKDMQK DAVQQILRQV SAFTSAGLEH HHHHHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NeR45A.009 U-[15N-13C]
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1 mM | |
2 | MES | natural abundance | 20 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 100 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | H2O | 95 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NeR45A.010 U-[15N-13C]
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | natural abundance | 0.86 mM | |
10 | MES | natural abundance | 20 mM | |
11 | calcium chloride | natural abundance | 5 mM | |
12 | DTT | natural abundance | 100 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | D2O | [U-100% 2H] | 100 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NeR45A.008 U-15N, 5%13C
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | entity | natural abundance | 1.3 mM | |
17 | MES | natural abundance | 20 mM | |
18 | calcium chloride | natural abundance | 5 mM | |
19 | DTT | natural abundance | 100 mM | |
20 | sodium chloride | natural abundance | 100 mM | |
21 | sodium azide | natural abundance | 0.02 % | |
22 | D2O | [U-100% 2H] | 5 % | |
23 | H2O | 95 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NeR45A.009 U-[15N-13C]
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1 mM | |
2 | MES | natural abundance | 20 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 100 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | H2O | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NeR45A.009 U-[15N-13C]
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1 mM | |
2 | MES | natural abundance | 20 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 100 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | H2O | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NeR45A.009 U-[15N-13C]
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1 mM | |
2 | MES | natural abundance | 20 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 100 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | H2O | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NeR45A.009 U-[15N-13C]
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1 mM | |
2 | MES | natural abundance | 20 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 100 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | H2O | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NeR45A.009 U-[15N-13C]
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1 mM | |
2 | MES | natural abundance | 20 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 100 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | H2O | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NeR45A.009 U-[15N-13C]
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1 mM | |
2 | MES | natural abundance | 20 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 100 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | H2O | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NeR45A.009 U-[15N-13C]
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1 mM | |
2 | MES | natural abundance | 20 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 100 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | H2O | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NeR45A.009 U-[15N-13C]
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1 mM | |
2 | MES | natural abundance | 20 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 100 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | H2O | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NeR45A.010 U-[15N-13C]
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | natural abundance | 0.86 mM | |
10 | MES | natural abundance | 20 mM | |
11 | calcium chloride | natural abundance | 5 mM | |
12 | DTT | natural abundance | 100 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | D2O | [U-100% 2H] | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NeR45A.009 U-[15N-13C]
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1 mM | |
2 | MES | natural abundance | 20 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 100 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | H2O | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NeR45A.009 U-[15N-13C]
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1 mM | |
2 | MES | natural abundance | 20 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 100 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | H2O | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NeR45A.009 U-[15N-13C]
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1 mM | |
2 | MES | natural abundance | 20 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 100 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | H2O | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NeR45A.008 U-15N, 5%13C
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | entity | natural abundance | 1.3 mM | |
17 | MES | natural abundance | 20 mM | |
18 | calcium chloride | natural abundance | 5 mM | |
19 | DTT | natural abundance | 100 mM | |
20 | sodium chloride | natural abundance | 100 mM | |
21 | sodium azide | natural abundance | 0.02 % | |
22 | D2O | [U-100% 2H] | 5 % | |
23 | H2O | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NeR45A.009 U-[15N-13C]
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1 mM | |
2 | MES | natural abundance | 20 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 100 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | H2O | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NeR45A.009 U-[15N-13C]
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1 mM | |
2 | MES | natural abundance | 20 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 100 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | H2O | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details NeR45A.009 U-[15N-13C]
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1 mM | |
2 | MES | natural abundance | 20 mM | |
3 | calcium chloride | natural abundance | 5 mM | |
4 | DTT | natural abundance | 100 mM | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | H2O | 95 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_15568_2jxp.nef |
Input source #2: Coordindates | 2jxp.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGFKLRGQVSELPFERVYITAPAGLTIGSDLERVISTHTRAKVVNKAEKSEAIIQIVHAIREKRILSLSESGRVREFELVYRVAARLLDAHNAELASLQE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGFKLRGQVSELPFERVYITAPAGLTIGSDLERVISTHTRAKVVNKAEKSEAIIQIVHAIREKRILSLSESGRVREFELVYRVAARLLDAHNAELASLQE -------110-------120-------130-------140-------150----- IRLTRILPFLDAQELAKAAEEEMLYKDMQKDAVQQILRQVSAFTSAGLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||| IRLTRILPFLDAQELAKAAEEEMLYKDMQKDAVQQILRQVSAFTSAGLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 155 | 0 | 0 | 100.0 |
Content subtype: combined_15568_2jxp.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGFKLRGQVSELPFERVYITAPAGLTIGSDLERVISTHTRAKVVNKAEKSEAIIQIVHAIREKRILSLSESGRVREFELVYRVAARLLDAHNAELASLQE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGFKLRGQVSELPFERVYITAPAGLTIGSDLERVISTHTRAKVVNKAEKSEAIIQIVHAIREKRILSLSESGRVREFELVYRVAARLLDAHNAELASLQE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150----- IRLTRILPFLDAQELAKAAEEEMLYKDMQKDAVQQILRQVSAFTSAGLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||| IRLTRILPFLDAQELAKAAEEEMLYKDMQKDAVQQILRQVSAFTSAGLE -------110-------120-------130-------140---------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 948 | 846 | 89.2 |
13C chemical shifts | 715 | 650 | 90.9 |
15N chemical shifts | 175 | 153 | 87.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 313 | 297 | 94.9 |
13C chemical shifts | 310 | 295 | 95.2 |
15N chemical shifts | 152 | 143 | 94.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 635 | 549 | 86.5 |
13C chemical shifts | 405 | 355 | 87.7 |
15N chemical shifts | 23 | 10 | 43.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 107 | 105 | 98.1 |
13C chemical shifts | 107 | 105 | 98.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 55 | 31 | 56.4 |
13C chemical shifts | 55 | 31 | 56.4 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGFKLRGQVSELPFERVYITAPAGLTIGSDLERVISTHTRAKVVNKAEKSEAIIQIVHAIREKRILSLSESGRVREFELVYRVAARLLDAHNAELASLQE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..FKLRGQVSELPFERVYITAPAGLTIGSDLERVISTHTRAKVVNKAEKSEAIIQIVHAIREKRILSLSESGRVREFELVYRVAARLLDAHNAELASLQE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150----- IRLTRILPFLDAQELAKAAEEEMLYKDMQKDAVQQILRQVSAFTSAGLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||| IRLTRILPFLDAQELAKAAEEEMLYKDMQKDAVQQILRQVSAFTSAGLE -------110-------120-------130-------140---------