Solution structure of protein ATU1810 from Agrobacterium tumefaciens; Northeast Structural Genomics Target AtR23; Ontario Center for Structural Proteomics Target ATC1776
QGHMSAKIYR PAKTAMQSGT AKTNVWVLEF DAEVPRKIDP IMGYTSSSDM KQQVKLTFET QEQAEAYAQR KGIEYRVILP KEATRKVVSY TDNFRFNRTQ PWTHGS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.1 % (1130 of 1268) | 90.1 % (599 of 665) | 87.5 % (428 of 489) | 90.4 % (103 of 114) |
Backbone | 92.5 % (579 of 626) | 92.9 % (197 of 212) | 92.3 % (289 of 313) | 92.1 % (93 of 101) |
Sidechain | 84.9 % (631 of 743) | 87.0 % (394 of 453) | 82.3 % (228 of 277) | 69.2 % (9 of 13) |
Aromatic | 60.7 % (68 of 112) | 73.2 % (41 of 56) | 46.3 % (25 of 54) | 100.0 % (2 of 2) |
Methyl | 93.9 % (92 of 98) | 93.9 % (46 of 49) | 93.9 % (46 of 49) |
1. Atu1810
QGHMSAKIYR PAKTAMQSGT AKTNVWVLEF DAEVPRKIDP IMGYTSSSDM KQQVKLTFET QEQAEAYAQR KGIEYRVILP KEATRKVVSY TDNFRFNRTQ PWTHGSSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atu1810 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | benzamidine | natural abundance | 10 mM | |
6 | D2O | [U-100% 2H] | 10 % | |
7 | H2O | 90 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | Atu1810 | [U-13C; U-15N] | 0.5 mM | |
9 | TRIS | natural abundance | 10 mM | |
10 | sodium chloride | natural abundance | 300 mM | |
11 | sodium azide | natural abundance | 0.1 % | |
12 | benzamidine | natural abundance | 10 mM | |
13 | D2O | [U-100% 2H] | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atu1810 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | benzamidine | natural abundance | 10 mM | |
6 | D2O | [U-100% 2H] | 10 % | |
7 | H2O | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | Atu1810 | [U-13C; U-15N] | 0.5 mM | |
9 | TRIS | natural abundance | 10 mM | |
10 | sodium chloride | natural abundance | 300 mM | |
11 | sodium azide | natural abundance | 0.1 % | |
12 | benzamidine | natural abundance | 10 mM | |
13 | D2O | [U-100% 2H] | 100 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atu1810 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | benzamidine | natural abundance | 10 mM | |
6 | D2O | [U-100% 2H] | 10 % | |
7 | H2O | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atu1810 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | benzamidine | natural abundance | 10 mM | |
6 | D2O | [U-100% 2H] | 10 % | |
7 | H2O | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atu1810 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | benzamidine | natural abundance | 10 mM | |
6 | D2O | [U-100% 2H] | 10 % | |
7 | H2O | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atu1810 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | benzamidine | natural abundance | 10 mM | |
6 | D2O | [U-100% 2H] | 10 % | |
7 | H2O | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atu1810 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | benzamidine | natural abundance | 10 mM | |
6 | D2O | [U-100% 2H] | 10 % | |
7 | H2O | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atu1810 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | benzamidine | natural abundance | 10 mM | |
6 | D2O | [U-100% 2H] | 10 % | |
7 | H2O | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | Atu1810 | [U-13C; U-15N] | 0.5 mM | |
9 | TRIS | natural abundance | 10 mM | |
10 | sodium chloride | natural abundance | 300 mM | |
11 | sodium azide | natural abundance | 0.1 % | |
12 | benzamidine | natural abundance | 10 mM | |
13 | D2O | [U-100% 2H] | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | Atu1810 | [U-13C; U-15N] | 0.5 mM | |
9 | TRIS | natural abundance | 10 mM | |
10 | sodium chloride | natural abundance | 300 mM | |
11 | sodium azide | natural abundance | 0.1 % | |
12 | benzamidine | natural abundance | 10 mM | |
13 | D2O | [U-100% 2H] | 100 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atu1810 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | benzamidine | natural abundance | 10 mM | |
6 | D2O | [U-100% 2H] | 10 % | |
7 | H2O | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atu1810 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | benzamidine | natural abundance | 10 mM | |
6 | D2O | [U-100% 2H] | 10 % | |
7 | H2O | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atu1810 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | benzamidine | natural abundance | 10 mM | |
6 | D2O | [U-100% 2H] | 10 % | |
7 | H2O | 90 % |
Bruker Avance - 500 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atu1810 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | benzamidine | natural abundance | 10 mM | |
6 | D2O | [U-100% 2H] | 10 % | |
7 | H2O | 90 % |
Bruker Avance - 500 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atu1810 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | benzamidine | natural abundance | 10 mM | |
6 | D2O | [U-100% 2H] | 10 % | |
7 | H2O | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_15585_2jya.nef |
Input source #2: Coordindates | 2jya.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-----------10--------20--------30--------40--------50--------60--------70--------80--------90------- QGHMSAKIYRPAKTAMQSGTAKTNVWVLEFDAEVPRKIDPIMGYTSSSDMKQQVKLTFETQEQAEAYAQRKGIEYRVILPKEATRKVVSYTDNFRFNRTQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| QGHMSAKIYRPAKTAMQSGTAKTNVWVLEFDAEVPRKIDPIMGYTSSSDMKQQVKLTFETQEQAEAYAQRKGIEYRVILPKEATRKVVSYTDNFRFNRTQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 100--- PWTHGS |||||| PWTHGS ------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 106 | 0 | 0 | 100.0 |
Content subtype: combined_15585_2jya.nef
Assigned chemical shifts
-----------10--------20--------30--------40--------50--------60--------70--------80--------90------- QGHMSAKIYRPAKTAMQSGTAKTNVWVLEFDAEVPRKIDPIMGYTSSSDMKQQVKLTFETQEQAEAYAQRKGIEYRVILPKEATRKVVSYTDNFRFNRTQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...MSAKIYRPAKTAMQSGTAKTNVWVLEFDAEVPRKIDPIMGYTSSSDMKQQVKLTFETQEQAEAYAQRKGIEYRVILPKEATRKVVSYTDNFRFNRTQ -----------10--------20--------30--------40--------50--------60--------70--------80--------90------- 100--- PWTHGS |||| PWTH 100-
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 665 | 583 | 87.7 |
13C chemical shifts | 489 | 416 | 85.1 |
15N chemical shifts | 121 | 100 | 82.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 212 | 193 | 91.0 |
13C chemical shifts | 212 | 190 | 89.6 |
15N chemical shifts | 101 | 92 | 91.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 453 | 390 | 86.1 |
13C chemical shifts | 277 | 226 | 81.6 |
15N chemical shifts | 20 | 8 | 40.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 53 | 43 | 81.1 |
13C chemical shifts | 53 | 43 | 81.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 56 | 41 | 73.2 |
13C chemical shifts | 54 | 25 | 46.3 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
-----------10--------20--------30--------40--------50--------60--------70--------80--------90------- QGHMSAKIYRPAKTAMQSGTAKTNVWVLEFDAEVPRKIDPIMGYTSSSDMKQQVKLTFETQEQAEAYAQRKGIEYRVILPKEATRKVVSYTDNFRFNRTQ |||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||| ...MSAKIYRPAKTAMQSGTAKTNVWVLEFDAEVPRKIDPIMGYT.SSDMKQQVKLTFETQEQAEAYAQRKGIEYRVILPKEATRKVVSYTDNFRFNRTQ -----------10--------20--------30--------40--------50--------60--------70--------80--------90------- 100--- PWTHGS ||| PWT 100
Dihedral angle restraints
-----------10--------20--------30--------40--------50--------60--------70--------80--------90------- QGHMSAKIYRPAKTAMQSGTAKTNVWVLEFDAEVPRKIDPIMGYTSSSDMKQQVKLTFETQEQAEAYAQRKGIEYRVILPKEATRKVVSYTDNFRFNRTQ |||||||| ||||||| ||||| ||| |||||||||||||||||||||||||||| || ...MSAKIYRP.............VWVLEFD......IDPIM..TSS.....QVKLTFETQEQAEAYAQRKGIEYRVILP..................TQ -----------10--------20--------30--------40--------50--------60--------70--------80--------90------- 100--- PWTHGS | P -
RDC restraints