solution structure of 50S ribosomal protein L28 from Thermotoga maritima: Northeast Structural Genomics consortium target VR97
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 74.8 % (673 of 900) | 80.5 % (385 of 478) | 65.8 % (225 of 342) | 78.8 % (63 of 80) |
Backbone | 69.1 % (315 of 456) | 81.0 % (128 of 158) | 57.1 % (128 of 224) | 79.7 % (59 of 74) |
Sidechain | 81.1 % (417 of 514) | 80.6 % (258 of 320) | 82.4 % (155 of 188) | 66.7 % (4 of 6) |
Aromatic | 68.4 % (26 of 38) | 78.9 % (15 of 19) | 55.6 % (10 of 18) | 100.0 % (1 of 1) |
Methyl | 94.3 % (66 of 70) | 94.3 % (33 of 35) | 94.3 % (33 of 35) |
1. ribosomal protein L28
QGHMIMAKRC EVCGKAPRSG NTVSHSDKKS ERWFRPNLQK VRVVLPDGTI KRMRVCTSCL KSGKVKKYVG QVSEVGSSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1.0 mM | |
2 | NaCl | natural abundance | 300 mM | |
3 | D2O | [U-100% 2H] | 10 % | |
4 | H2O | 90 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | null | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | null | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | null | indirect | 0.4048086 |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1.0 mM | |
2 | NaCl | natural abundance | 300 mM | |
3 | D2O | [U-100% 2H] | 10 % | |
4 | H2O | 90 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1.0 mM | |
2 | NaCl | natural abundance | 300 mM | |
3 | D2O | [U-100% 2H] | 10 % | |
4 | H2O | 90 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1.0 mM | |
2 | NaCl | natural abundance | 300 mM | |
3 | D2O | [U-100% 2H] | 10 % | |
4 | H2O | 90 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1.0 mM | |
2 | NaCl | natural abundance | 300 mM | |
3 | D2O | [U-100% 2H] | 10 % | |
4 | H2O | 90 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1.0 mM | |
2 | NaCl | natural abundance | 300 mM | |
3 | D2O | [U-100% 2H] | 10 % | |
4 | H2O | 90 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1.0 mM | |
2 | NaCl | natural abundance | 300 mM | |
3 | D2O | [U-100% 2H] | 10 % | |
4 | H2O | 90 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1.0 mM | |
2 | NaCl | natural abundance | 300 mM | |
3 | D2O | [U-100% 2H] | 10 % | |
4 | H2O | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15609_2jz6.nef |
Input source #2: Coordindates | 2jz6.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70------- QGHMIMAKRCEVCGKAPRSGNTVSHSDKKSERWFRPNLQKVRVVLPDGTIKRMRVCTSCLKSGKVKKYVGQVSEVGS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| QGHMIMAKRCEVCGKAPRSGNTVSHSDKKSERWFRPNLQKVRVVLPDGTIKRMRVCTSCLKSGKVKKYVGQVSEVGS
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 77 | 0 | 0 | 100.0 |
Content subtype: combined_15609_2jz6.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70------- QGHMIMAKRCEVCGKAPRSGNTVSHSDKKSERWFRPNLQKVRVVLPDGTIKRMRVCTSCLKSGKVKKYVGQVSEVGS ||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||| ....IMAKRCEVCGKAP.............ERWFRPNLQKVRVVLPDGTIKRMRVCTSCLKSGKVKKYVGQVSEVGS
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 478 | 374 | 78.2 |
13C chemical shifts | 342 | 210 | 61.4 |
15N chemical shifts | 87 | 61 | 70.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 158 | 122 | 77.2 |
13C chemical shifts | 154 | 60 | 39.0 |
15N chemical shifts | 74 | 57 | 77.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 320 | 252 | 78.7 |
13C chemical shifts | 188 | 150 | 79.8 |
15N chemical shifts | 13 | 4 | 30.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 38 | 33 | 86.8 |
13C chemical shifts | 38 | 33 | 86.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 19 | 15 | 78.9 |
13C chemical shifts | 18 | 10 | 55.6 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70------- QGHMIMAKRCEVCGKAPRSGNTVSHSDKKSERWFRPNLQKVRVVLPDGTIKRMRVCTSCLKSGKVKKYVGQVSEVGS | |||||||||| |||||||||||||||||||||||||||||||||||||||| ....I..KRCEVCGKAP..............RWFRPNLQKVRVVLPDGTIKRMRVCTSCLKSGKVKKYVGQ --------10--------20--------30--------40--------50--------60--------70-
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70------- QGHMIMAKRCEVCGKAPRSGNTVSHSDKKSERWFRPNLQKVRVVLPDGTIKRMRVCTSCLKSGKVKKYVGQVSEVGS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...MIMAKRCEVCGKAPRSGNTVSHSDKKSERWFRPNLQKVRVVLPDGTIKRMRVCTSCLKSGKVKKYVGQVS --------10--------20--------30--------40--------50--------60--------70---