Solution NMR structure of Nitrite reductase [NAD(P)H] small subunit from Erwinia carotovora, Northeast Structural Genomics Consortium target EwR120.
MSQWTTVCKL DDILPGTGVC ALVEQQQIAV FRPRNDEQVY AISNIDPFAQ ASVLSRGIVA EHQDDLWVAS PLKKQHFRLY DGFCLEDGAY SVAAYDTQVT NGNVQISIAD SDVAVDNSQP LPLEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.5 % (1330 of 1470) | 92.0 % (693 of 753) | 87.7 % (504 of 575) | 93.7 % (133 of 142) |
Backbone | 91.9 % (706 of 768) | 91.9 % (239 of 260) | 91.7 % (352 of 384) | 92.7 % (115 of 124) |
Sidechain | 89.6 % (740 of 826) | 92.1 % (454 of 493) | 85.1 % (268 of 315) | 100.0 % (18 of 18) |
Aromatic | 58.6 % (75 of 128) | 71.9 % (46 of 64) | 43.5 % (27 of 62) | 100.0 % (2 of 2) |
Methyl | 98.7 % (152 of 154) | 100.0 % (77 of 77) | 97.4 % (75 of 77) |
1. ewr120 protein
MSQWTTVCKL DDILPGTGVC ALVEQQQIAV FRPRNDEQVY AISNIDPFAQ ASVLSRGIVA EHQDDLWVAS PLKKQHFRLY DGFCLEDGAY SVAAYDTQVT NGNVQISIAD SDVAVDNSQP LPLEHHHHHHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ewr120 protein | [U-5% 13C; U-100% 15N] | 0.24 mM | |
2 | calcium chloride | natural abundance | 5 mM | |
3 | ammonium acetate | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | H2O | 95 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ewr120 protein | [U-100% 13C; U-100% 15N] | 0.7 mM | |
10 | calcium chloride | natural abundance | 5 mM | |
11 | ammonium acetate | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | D2O | [U-100% 2H] | 5 % | |
16 | H2O | 95 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | ewr120 protein | [U-100% 13C; U-100% 15N] | 0.32 mM | |
18 | calcium chloride | natural abundance | 5 mM | |
19 | ammonium acetate | natural abundance | 20 mM | |
20 | sodium chloride | natural abundance | 100 mM | |
21 | DTT | natural abundance | 10 mM | |
22 | sodium azide | natural abundance | 0.02 % | |
23 | D2O | [U-100% 2H] | 5 % | |
24 | H2O | 95 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | ewr120 protein | [U-100% 13C; U-100% 15N] | 0.32 mM | |
18 | calcium chloride | natural abundance | 5 mM | |
19 | ammonium acetate | natural abundance | 20 mM | |
20 | sodium chloride | natural abundance | 100 mM | |
21 | DTT | natural abundance | 10 mM | |
22 | sodium azide | natural abundance | 0.02 % | |
23 | D2O | [U-100% 2H] | 5 % | |
24 | H2O | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | ewr120 protein | [U-100% 13C; U-100% 15N] | 0.32 mM | |
18 | calcium chloride | natural abundance | 5 mM | |
19 | ammonium acetate | natural abundance | 20 mM | |
20 | sodium chloride | natural abundance | 100 mM | |
21 | DTT | natural abundance | 10 mM | |
22 | sodium azide | natural abundance | 0.02 % | |
23 | D2O | [U-100% 2H] | 5 % | |
24 | H2O | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | ewr120 protein | [U-100% 13C; U-100% 15N] | 0.32 mM | |
18 | calcium chloride | natural abundance | 5 mM | |
19 | ammonium acetate | natural abundance | 20 mM | |
20 | sodium chloride | natural abundance | 100 mM | |
21 | DTT | natural abundance | 10 mM | |
22 | sodium azide | natural abundance | 0.02 % | |
23 | D2O | [U-100% 2H] | 5 % | |
24 | H2O | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | ewr120 protein | [U-100% 13C; U-100% 15N] | 0.32 mM | |
18 | calcium chloride | natural abundance | 5 mM | |
19 | ammonium acetate | natural abundance | 20 mM | |
20 | sodium chloride | natural abundance | 100 mM | |
21 | DTT | natural abundance | 10 mM | |
22 | sodium azide | natural abundance | 0.02 % | |
23 | D2O | [U-100% 2H] | 5 % | |
24 | H2O | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | ewr120 protein | [U-100% 13C; U-100% 15N] | 0.32 mM | |
18 | calcium chloride | natural abundance | 5 mM | |
19 | ammonium acetate | natural abundance | 20 mM | |
20 | sodium chloride | natural abundance | 100 mM | |
21 | DTT | natural abundance | 10 mM | |
22 | sodium azide | natural abundance | 0.02 % | |
23 | D2O | [U-100% 2H] | 5 % | |
24 | H2O | 95 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ewr120 protein | [U-100% 13C; U-100% 15N] | 0.7 mM | |
10 | calcium chloride | natural abundance | 5 mM | |
11 | ammonium acetate | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | D2O | [U-100% 2H] | 5 % | |
16 | H2O | 95 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ewr120 protein | [U-100% 13C; U-100% 15N] | 0.7 mM | |
10 | calcium chloride | natural abundance | 5 mM | |
11 | ammonium acetate | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | D2O | [U-100% 2H] | 5 % | |
16 | H2O | 95 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ewr120 protein | [U-100% 13C; U-100% 15N] | 0.7 mM | |
10 | calcium chloride | natural abundance | 5 mM | |
11 | ammonium acetate | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | D2O | [U-100% 2H] | 5 % | |
16 | H2O | 95 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ewr120 protein | [U-100% 13C; U-100% 15N] | 0.7 mM | |
10 | calcium chloride | natural abundance | 5 mM | |
11 | ammonium acetate | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | D2O | [U-100% 2H] | 5 % | |
16 | H2O | 95 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ewr120 protein | [U-100% 13C; U-100% 15N] | 0.7 mM | |
10 | calcium chloride | natural abundance | 5 mM | |
11 | ammonium acetate | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | D2O | [U-100% 2H] | 5 % | |
16 | H2O | 95 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ewr120 protein | [U-100% 13C; U-100% 15N] | 0.7 mM | |
10 | calcium chloride | natural abundance | 5 mM | |
11 | ammonium acetate | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | D2O | [U-100% 2H] | 5 % | |
16 | H2O | 95 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ewr120 protein | [U-100% 13C; U-100% 15N] | 0.7 mM | |
10 | calcium chloride | natural abundance | 5 mM | |
11 | ammonium acetate | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | D2O | [U-100% 2H] | 5 % | |
16 | H2O | 95 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ewr120 protein | [U-100% 13C; U-100% 15N] | 0.7 mM | |
10 | calcium chloride | natural abundance | 5 mM | |
11 | ammonium acetate | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | D2O | [U-100% 2H] | 5 % | |
16 | H2O | 95 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ewr120 protein | [U-100% 13C; U-100% 15N] | 0.7 mM | |
10 | calcium chloride | natural abundance | 5 mM | |
11 | ammonium acetate | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | D2O | [U-100% 2H] | 5 % | |
16 | H2O | 95 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ewr120 protein | [U-100% 13C; U-100% 15N] | 0.7 mM | |
10 | calcium chloride | natural abundance | 5 mM | |
11 | ammonium acetate | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | D2O | [U-100% 2H] | 5 % | |
16 | H2O | 95 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ewr120 protein | [U-100% 13C; U-100% 15N] | 0.7 mM | |
10 | calcium chloride | natural abundance | 5 mM | |
11 | ammonium acetate | natural abundance | 20 mM | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | D2O | [U-100% 2H] | 5 % | |
16 | H2O | 95 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ewr120 protein | [U-5% 13C; U-100% 15N] | 0.24 mM | |
2 | calcium chloride | natural abundance | 5 mM | |
3 | ammonium acetate | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | H2O | 95 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ewr120 protein | [U-5% 13C; U-100% 15N] | 0.24 mM | |
2 | calcium chloride | natural abundance | 5 mM | |
3 | ammonium acetate | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 100 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | D2O | [U-100% 2H] | 5 % | |
8 | H2O | 95 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15611_2jza.nef |
Input source #2: Coordindates | 2jza.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSQWTTVCKLDDILPGTGVCALVEQQQIAVFRPRNDEQVYAISNIDPFAQASVLSRGIVAEHQDDLWVASPLKKQHFRLYDGFCLEDGAYSVAAYDTQVT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSQWTTVCKLDDILPGTGVCALVEQQQIAVFRPRNDEQVYAISNIDPFAQASVLSRGIVAEHQDDLWVASPLKKQHFRLYDGFCLEDGAYSVAAYDTQVT -------110-------120-------130 NGNVQISIADSDVAVDNSQPLPLEHHHHHH |||||||||||||||||||||||||||||| NGNVQISIADSDVAVDNSQPLPLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 130 | 0 | 0 | 100.0 |
Content subtype: combined_15611_2jza.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSQWTTVCKLDDILPGTGVCALVEQQQIAVFRPRNDEQVYAISNIDPFAQASVLSRGIVAEHQDDLWVASPLKKQHFRLYDGFCLEDGAYSVAAYDTQVT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..QWTTVCKLDDILPGTGVCALVEQQQIAVFRPRNDEQVYAISNIDPFAQASVLSRGIVAEHQDDLWVASPLKKQHFRLYDGFCLEDGAYSVAAYDTQVT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130 NGNVQISIADSDVAVDNSQPLPLEHHHHHH ||||||||||||||||||||||||| NGNVQISIADSDVAVDNSQPLPLEH -------110-------120-----
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
17 | THR | HG1 | 6.534 |
32 | ARG | HH21 | 6.13 |
32 | ARG | HH22 | 6.13 |
62 | HIS | ND1 | 213.033 |
62 | HIS | NE2 | 180.582 |
76 | HIS | ND1 | 182.351 |
76 | HIS | NE2 | 172.969 |
78 | ARG | HH11 | 6.312 |
78 | ARG | HH12 | 6.312 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 753 | 699 | 92.8 |
13C chemical shifts | 575 | 506 | 88.0 |
15N chemical shifts | 146 | 137 | 93.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 260 | 243 | 93.5 |
13C chemical shifts | 260 | 237 | 91.2 |
15N chemical shifts | 124 | 115 | 92.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 493 | 456 | 92.5 |
13C chemical shifts | 315 | 269 | 85.4 |
15N chemical shifts | 22 | 22 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 78 | 77 | 98.7 |
13C chemical shifts | 78 | 75 | 96.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 64 | 46 | 71.9 |
13C chemical shifts | 62 | 27 | 43.5 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSQWTTVCKLDDILPGTGVCALVEQQQIAVFRPRNDEQVYAISNIDPFAQASVLSRGIVAEHQDDLWVASPLKKQHFRLYDGFCLEDGAYSVAAYDTQVT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..QWTTVCKLDDILPGTGVCALVEQQQIAVFRPRNDEQVYAISNIDPFAQASVLSRGIVAEHQDDLWVASPLKKQHFRLYDGFCLEDGAYSVAAYDTQVT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130 NGNVQISIADSDVAVDNSQPLPLEHHHHHH ||||||||||||||||||||||| NGNVQISIADSDVAVDNSQPLPL -------110-------120---
Dihedral angle restraints