Solution structure of the aminoterminal domain of E. coli NusG
MSEAPKKRWY VVQAFSGFEG RVATSLREHI KLHNMEDLFG EVMVPTEEVV EIRGGQRRKS ERKFFPGYVL VQMVMNDASW HLVRSVPRVM GFIGGTSDRP APISDKEVDA IMNRLQQVGD KPR
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 88.9 % (1301 of 1463) | 86.9 % (669 of 770) | 89.9 % (510 of 567) | 96.8 % (122 of 126) |
Backbone | 96.0 % (695 of 724) | 96.4 % (240 of 249) | 94.7 % (340 of 359) | 99.1 % (115 of 116) |
Sidechain | 83.1 % (708 of 852) | 82.3 % (429 of 521) | 84.7 % (272 of 321) | 70.0 % (7 of 10) |
Aromatic | 79.5 % (89 of 112) | 83.9 % (47 of 56) | 74.1 % (40 of 54) | 100.0 % (2 of 2) |
Methyl | 95.9 % (117 of 122) | 93.4 % (57 of 61) | 98.4 % (60 of 61) |
1. NusG
MSEAPKKRWY VVQAFSGFEG RVATSLREHI KLHNMEDLFG EVMVPTEEVV EIRGGQRRKS ERKFFPGYVL VQMVMNDASW HLVRSVPRVM GFIGGTSDRP APISDKEVDA IMNRLQQVGD KPRSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.4 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | H2O | 90 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.4 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | H2O | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.4 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | H2O | 90 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.4 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | H2O | 90 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.4 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | H2O | 90 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.4 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | H2O | 90 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.4 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | H2O | 90 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.4 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | H2O | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.4 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | H2O | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.4 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | H2O | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15642_2k06.nef |
Input source #2: Coordindates | 2k06.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSEAPKKRWYVVQAFSGFEGRVATSLREHIKLHNMEDLFGEVMVPTEEVVEIRGGQRRKSERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSEAPKKRWYVVQAFSGFEGRVATSLREHIKLHNMEDLFGEVMVPTEEVVEIRGGQRRKSERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRP -------110-------120--- APISDKEVDAIMNRLQQVGDKPR ||||||||||||||||||||||| APISDKEVDAIMNRLQQVGDKPR
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 123 | 0 | 0 | 100.0 |
Content subtype: combined_15642_2k06.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSEAPKKRWYVVQAFSGFEGRVATSLREHIKLHNMEDLFGEVMVPTEEVVEIRGGQRRKSERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSEAPKKRWYVVQAFSGFEGRVATSLREHIKLHNMEDLFGEVMVPTEEVVEIRGGQRRKSERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRP -------110-------120--- APISDKEVDAIMNRLQQVGDKPR ||||||||||||||||||||||| APISDKEVDAIMNRLQQVGDKPR
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 567 | 498 | 87.8 |
1H chemical shifts | 770 | 662 | 86.0 |
15N chemical shifts | 138 | 122 | 88.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 246 | 236 | 95.9 |
1H chemical shifts | 249 | 246 | 98.8 |
15N chemical shifts | 116 | 115 | 99.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 321 | 262 | 81.6 |
1H chemical shifts | 521 | 416 | 79.8 |
15N chemical shifts | 22 | 7 | 31.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 68 | 64 | 94.1 |
1H chemical shifts | 68 | 64 | 94.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 54 | 40 | 74.1 |
1H chemical shifts | 56 | 47 | 83.9 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSEAPKKRWYVVQAFSGFEGRVATSLREHIKLHNMEDLFGEVMVPTEEVVEIRGGQRRKSERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRP ||||||||||||||||||||||||||||||||||||||||||||| ||||| ||||||| |||||||||||||||||||||||||||||||||| ..EAPKKRWYVVQAFSGFEGRVATSLREHIKLHNMEDLFGEVMVPTE.VVEIR.....KSERKFF.GYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRP --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120--- APISDKEVDAIMNRLQQVGDKPR |||||||||||||||||||| APISDKEVDAIMNRLQQVGD -------110-------120
Dihedral angle restraints