Solution NMR structure of the uncharacterized protein from Rhodospirillum rubrum gene locus Rru_A0810. Northeast Structural Genomics Target RrR43.
MAKAQPIEIA GHEFARKADA LAFMKVMLNR YRPGDIVSTV DGAFLVEALK RHPDATSKIG PGVRNFEVRS ADYGTQCFWI LRTDGSEERF SYKKCVLEHH HHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.6 % (1101 of 1215) | 90.8 % (573 of 631) | 91.0 % (436 of 479) | 87.6 % (92 of 105) |
Backbone | 90.3 % (556 of 616) | 91.0 % (192 of 211) | 90.8 % (277 of 305) | 87.0 % (87 of 100) |
Sidechain | 91.2 % (635 of 696) | 90.7 % (381 of 420) | 91.9 % (249 of 271) | 100.0 % (5 of 5) |
Aromatic | 79.7 % (102 of 128) | 79.7 % (51 of 64) | 79.4 % (50 of 63) | 100.0 % (1 of 1) |
Methyl | 100.0 % (102 of 102) | 100.0 % (51 of 51) | 100.0 % (51 of 51) |
1. RrR43
MAKAQPIEIA GHEFARKADA LAFMKVMLNR YRPGDIVSTV DGAFLVEALK RHPDATSKIG PGVRNFEVRS ADYGTQCFWI LRTDGSEERF SYKKCVLEHH HHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details RrR43.004
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RrR43 | [U-5% 13C; U-100% 15N] | 1.15 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details RrR43.002
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | RrR43 | [U-100% 13C; U-100% 15N] | 1.05 mM | |
9 | MES | natural abundance | 20 mM | |
10 | DTT | natural abundance | 10 mM | |
11 | sodium azide | natural abundance | 0.02 % | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | DSS | natural abundance | 50 uM | |
14 | calcium chloride | natural abundance | 5 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details RrR43.004
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RrR43 | [U-5% 13C; U-100% 15N] | 1.15 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details RrR43.004
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RrR43 | [U-5% 13C; U-100% 15N] | 1.15 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details RrR43.004
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RrR43 | [U-5% 13C; U-100% 15N] | 1.15 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details RrR43.004
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RrR43 | [U-5% 13C; U-100% 15N] | 1.15 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details RrR43.004
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RrR43 | [U-5% 13C; U-100% 15N] | 1.15 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details RrR43.004
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RrR43 | [U-5% 13C; U-100% 15N] | 1.15 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details RrR43.004
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RrR43 | [U-5% 13C; U-100% 15N] | 1.15 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details RrR43.004
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RrR43 | [U-5% 13C; U-100% 15N] | 1.15 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details RrR43.004
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RrR43 | [U-5% 13C; U-100% 15N] | 1.15 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details RrR43.004
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RrR43 | [U-5% 13C; U-100% 15N] | 1.15 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details RrR43.004
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RrR43 | [U-5% 13C; U-100% 15N] | 1.15 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details RrR43.004
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RrR43 | [U-5% 13C; U-100% 15N] | 1.15 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details RrR43.002
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | RrR43 | [U-100% 13C; U-100% 15N] | 1.05 mM | |
9 | MES | natural abundance | 20 mM | |
10 | DTT | natural abundance | 10 mM | |
11 | sodium azide | natural abundance | 0.02 % | |
12 | sodium chloride | natural abundance | 100 mM | |
13 | DSS | natural abundance | 50 uM | |
14 | calcium chloride | natural abundance | 5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details RrR43.004
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RrR43 | [U-5% 13C; U-100% 15N] | 1.15 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details RrR43.004
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RrR43 | [U-5% 13C; U-100% 15N] | 1.15 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | sodium chloride | natural abundance | 100 mM | |
6 | DSS | natural abundance | 50 uM | |
7 | calcium chloride | natural abundance | 5 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_15652_2k0m.nef |
Input source #2: Coordindates | 2k0m.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAKAQPIEIAGHEFARKADALAFMKVMLNRYRPGDIVSTVDGAFLVEALKRHPDATSKIGPGVRNFEVRSADYGTQCFWILRTDGSEERFSYKKCVLEHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAKAQPIEIAGHEFARKADALAFMKVMLNRYRPGDIVSTVDGAFLVEALKRHPDATSKIGPGVRNFEVRSADYGTQCFWILRTDGSEERFSYKKCVLEHH ---- HHHH |||| HHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 104 | 0 | 0 | 100.0 |
Content subtype: combined_15652_2k0m.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAKAQPIEIAGHEFARKADALAFMKVMLNRYRPGDIVSTVDGAFLVEALKRHPDATSKIGPGVRNFEVRSADYGTQCFWILRTDGSEERFSYKKCVLEHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AKAQPIEIAGHEFARKADALAFMKVMLNRYRPGDIVSTVDGAFLVEALKRHPDATSKIGPGVRNFEVRSADYGTQCFWILRTDGSEERFSYKKCVLE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------- ---- HHHH
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 631 | 571 | 90.5 |
13C chemical shifts | 479 | 435 | 90.8 |
15N chemical shifts | 113 | 90 | 79.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 211 | 190 | 90.0 |
13C chemical shifts | 208 | 186 | 89.4 |
15N chemical shifts | 100 | 85 | 85.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 420 | 381 | 90.7 |
13C chemical shifts | 271 | 249 | 91.9 |
15N chemical shifts | 13 | 5 | 38.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 53 | 98.1 |
13C chemical shifts | 54 | 53 | 98.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 64 | 51 | 79.7 |
13C chemical shifts | 63 | 50 | 79.4 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAKAQPIEIAGHEFARKADALAFMKVMLNRYRPGDIVSTVDGAFLVEALKRHPDATSKIGPGVRNFEVRSADYGTQCFWILRTDGSEERFSYKKCVLEHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..KAQPIEIAGHEFARKADALAFMKVMLNRYRPGDIVSTVDGAFLVEALKRHPDATSKIGPGVRNFEVRSADYGTQCFWILRTDGSEERFSYKKCVLE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------- ---- HHHH