Solution structure of the free TAF3 PHD domain
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 88.7 % (777 of 876) | 97.2 % (448 of 461) | 76.0 % (256 of 337) | 93.6 % (73 of 78) |
Backbone | 82.3 % (359 of 436) | 97.3 % (145 of 149) | 68.9 % (151 of 219) | 92.6 % (63 of 68) |
Sidechain | 95.5 % (486 of 509) | 97.1 % (303 of 312) | 92.5 % (173 of 187) | 100.0 % (10 of 10) |
Aromatic | 89.8 % (88 of 98) | 95.9 % (47 of 49) | 81.8 % (36 of 44) | 100.0 % (5 of 5) |
Methyl | 100.0 % (42 of 42) | 100.0 % (21 of 21) | 100.0 % (21 of 21) |
1. TAF3 PHD
GSHMAMAYVI RDEWGNQIWI CPGCNKPDDG SPMIGCDDCD DWYHWPCVGI MAAPPEEMQW FCPKCANKIK KDKKHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TAF3_PHD | [U-13C; U-15N] | 150 mM | |
2 | potassium chloride | natural abundance | 150 mM | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | ZnCl2 | natural abundance | 0.01 mM | |
5 | H2O | 95 % | ||
6 | D2O | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.751 ppm | internal | direct | 1.0 |
15N | water | protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.751 ppm | internal | direct | 1.0 |
15N | water | protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.751 ppm | internal | direct | 1.0 |
15N | water | protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TAF3_PHD | [U-13C; U-15N] | 150 mM | |
2 | potassium chloride | natural abundance | 150 mM | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | ZnCl2 | natural abundance | 0.01 mM | |
5 | H2O | 95 % | ||
6 | D2O | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TAF3_PHD | [U-13C; U-15N] | 150 mM | |
2 | potassium chloride | natural abundance | 150 mM | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | ZnCl2 | natural abundance | 0.01 mM | |
5 | H2O | 95 % | ||
6 | D2O | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TAF3_PHD | [U-13C; U-15N] | 150 mM | |
2 | potassium chloride | natural abundance | 150 mM | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | ZnCl2 | natural abundance | 0.01 mM | |
5 | H2O | 95 % | ||
6 | D2O | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15670_2k16.nef |
Input source #2: Coordindates | 2k16.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
1:21:CYS:SG | 2:2:ZN:ZN | unknown | unknown | n/a |
1:24:CYS:SG | 2:2:ZN:ZN | unknown | unknown | n/a |
1:36:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:39:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:44:HIS:ND1 | 2:2:ZN:ZN | unknown | unknown | n/a |
1:47:CYS:SG | 2:2:ZN:ZN | unknown | unknown | n/a |
1:62:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:65:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | ZN | ZINC ION | None |
B | 2 | ZN | ZINC ION | None |
Sequence alignments
850-----860-------870-------880-------890-------900-------910-------920---- GSHMAMAYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMAAPPEEMQWFCPKCANKIKKDKKH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMAMAYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMAAPPEEMQWFCPKCANKIKKDKKH --------10--------20--------30--------40--------50--------60--------70-----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 75 | 0 | 0 | 100.0 |
Content subtype: combined_15670_2k16.nef
Assigned chemical shifts
850-----860-------870-------880-------890-------900-------910-------920---- GSHMAMAYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMAAPPEEMQWFCPKCANKIKKDKKH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMAMAYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMAAPPEEMQWFCPKCANKIKKDKKH
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
893 | HIS | HE2 | 10.705 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 461 | 451 | 97.8 |
13C chemical shifts | 337 | 247 | 73.3 |
15N chemical shifts | 79 | 73 | 92.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 149 | 146 | 98.0 |
13C chemical shifts | 150 | 74 | 49.3 |
15N chemical shifts | 68 | 63 | 92.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 312 | 305 | 97.8 |
13C chemical shifts | 187 | 173 | 92.5 |
15N chemical shifts | 11 | 10 | 90.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 26 | 22 | 84.6 |
13C chemical shifts | 26 | 22 | 84.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 49 | 47 | 95.9 |
13C chemical shifts | 44 | 36 | 81.8 |
15N chemical shifts | 5 | 5 | 100.0 |
Covalent bonds
Distance restraints
850-----860-------870-------880-------890-------900-------910-------920---- GSHMAMAYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMAAPPEEMQWFCPKCANKIKKDKKH || |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GS.MAMAYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMAAPPEEMQWFCPKCANKIKKDKKH
Dihedral angle restraints
850-----860-------870-------880-------890-------900-------910-------920---- GSHMAMAYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMAAPPEEMQWFCPKCANKIKKDKKH |||||| |||| |||| |||||| |||||||||| ||| |||||||||||| ........VIRDEW....WICP..NKPD.GSPMIG....DDWYHWPCVG....PPE.MQWFCPKCANKI 850-----860-------870-------880-------890-------900-------910--------