Solution NMR structure of the chromobox protein homolog 7
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 71.1 % (658 of 926) | 72.3 % (355 of 491) | 69.7 % (251 of 360) | 69.3 % (52 of 75) |
Backbone | 71.6 % (308 of 430) | 71.2 % (104 of 146) | 72.1 % (155 of 215) | 71.0 % (49 of 69) |
Sidechain | 71.5 % (404 of 565) | 72.8 % (251 of 345) | 70.1 % (150 of 214) | 50.0 % (3 of 6) |
Aromatic | 36.2 % (42 of 116) | 43.1 % (25 of 58) | 27.3 % (15 of 55) | 66.7 % (2 of 3) |
Methyl | 92.6 % (50 of 54) | 92.6 % (25 of 27) | 92.6 % (25 of 27) |
1. cbx7
MHHHHHHSSG RENLYFQGEQ VFAVESIRKK RVRKGKVEYL VKWKGWPPKY STWEPEEHIL DPRLVMAYEE KEESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphate | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 300 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | D2O | 10 % | ||
5 | H2O | natural abundance | 90 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphate | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 300 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | D2O | 10 % | ||
5 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphate | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 300 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | D2O | 10 % | ||
5 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphate | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 300 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | D2O | 10 % | ||
5 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphate | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 300 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | D2O | 10 % | ||
5 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphate | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 300 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | D2O | 10 % | ||
5 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphate | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 300 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | D2O | 10 % | ||
5 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphate | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 300 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | D2O | 10 % | ||
5 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphate | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 300 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | D2O | 10 % | ||
5 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphate | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 300 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | D2O | 10 % | ||
5 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphate | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 300 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | D2O | 10 % | ||
5 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | phosphate | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 300 mM | |
3 | DTT | natural abundance | 2 mM | |
4 | D2O | 10 % | ||
5 | H2O | natural abundance | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15674_2k1b.nef |
Input source #2: Coordindates | 2k1b.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------------------------10--------20--------30--------40--------50----- MHHHHHHSSGRENLYFQGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MHHHHHHSSGRENLYFQGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE --------10--------20--------30--------40--------50--------60--------70---
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 73 | 0 | 0 | 100.0 |
Content subtype: combined_15674_2k1b.nef
Assigned chemical shifts
--------------------------10--------20--------30--------40--------50----- MHHHHHHSSGRENLYFQGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE ||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..................EQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 491 | 360 | 73.3 |
13C chemical shifts | 360 | 248 | 68.9 |
15N chemical shifts | 80 | 51 | 63.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 146 | 105 | 71.9 |
13C chemical shifts | 146 | 100 | 68.5 |
15N chemical shifts | 69 | 48 | 69.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 345 | 255 | 73.9 |
13C chemical shifts | 214 | 148 | 69.2 |
15N chemical shifts | 11 | 3 | 27.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 29 | 25 | 86.2 |
13C chemical shifts | 29 | 25 | 86.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 58 | 25 | 43.1 |
13C chemical shifts | 55 | 15 | 27.3 |
15N chemical shifts | 3 | 2 | 66.7 |
Distance restraints
--------------------------10--------20--------30--------40--------50----- MHHHHHHSSGRENLYFQGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE ||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..................EQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE
Dihedral angle restraints
--------------------------10--------20--------30--------40--------50----- MHHHHHHSSGRENLYFQGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE ||||||||||||||||||||||||||||||||||||||| |||||||||| ....................VFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHI..PRLVMAYEEK --------------------------10--------20--------30--------40--------50---